KEGG   Thermacetogenium phaeum: Tph_c18900Help
Entry
Tph_c18900        CDS       T02276                                 

Gene name
bchI2
Definition
magnesium-chelatase BchI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tph_c18900 (bchI2)
Enzymes [BR:tpz01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tph_c18900 (bchI2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1910570..1911832)
Genome map
AA seq 420 aa AA seqDB search
MKNYLQLTRHKGNAPLFLAVEMSLVSTLQGRPLHIHAEGLRGTGKTTIMRSVTQILPKIT
RIKGCLYNCDPERPHCPQHKNMTPEEIAALGTEQIPVPFLEISHSAKIGTVAGTIDLAKL
TNPSRPEAALLPGIIPQAHRGIVFVDEINRLADTSPEITDVLLDAMGTKPGRVQIEETGL
PVVEVPVAVSVWAASNPDEEPGPLAEIRRQLSDRFDLVIPMGRPTTPEEVVDILTTEEAK
NDRELSEQERSQLEQLRKNLENIALHSDLTMPDYLTTFLANLYINFNIESLRALEAIRQA
ALLHCALRKRSQVMISDIMAVLPLALYHRVSPATLTEIMNTVNNRMVGNEKEKENGKRSA
QGRQLPPIFHNKKGDKRQMSEDSPPEKARLLRDLPENGIIRKESEIQTMIEKLTPRTWGG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactacctccagttgacccgtcacaaagggaacgctcctctcttcctggccgta
gaaatgtcccttgtctccaccctgcagggaagacccctgcacattcacgcagaagggctg
cgcggcacgggaaagaccactatcatgcgctcggttacacagatcctcccgaagatcacc
cgcatcaaggggtgtctctacaactgcgacccagagcgacctcactgcccgcagcacaaa
aacatgacgccggaagagatcgccgccctgggcacagaacagattcccgttccctttttg
gaaatctcccattccgccaagatcggtacggtcgccgggactatcgacctggccaagctc
accaatccctcccgaccggaggcggccctcctgcccggcatcatccctcaggcgcacagg
gggatagtcttcgtcgacgaaataaaccgcctggcagacacctcgccggaaataacggac
gttctcctcgatgccatgggcaccaagccagggcgcgtccagatagaggaaacgggcctt
cccgtcgtcgaggttcccgttgcggtttcggtttgggcggcatcaaaccccgatgaagag
ccggggcctttggcggagatccgccggcagctgtccgaccgcttcgatctggtcatcccc
atgggcaggccaaccacccctgaggaagtggtggatattctgacgacggaggaagccaag
aacgacagagagctttccgaacaggagcgcagccagctggaacagctgcgaaaaaacctg
gagaacatagccctgcacagcgatttgacgatgcccgattaccttacgacgtttctggcc
aacctctacatcaacttcaacatcgaaagcctccgggcgctggaagcgatccggcaggcc
gctctgttgcactgcgctttgaggaagcgcagccaggtcatgatcagcgacatcatggcg
gtacttccccttgccctttaccaccgggtcagcccggccacacttacggaaatcatgaat
accgtcaacaaccgcatggtcggcaatgagaaggagaaggagaacggcaaaagaagcgca
cagggacgccagctgccccctatttttcacaacaaaaagggagataagcggcagatgagc
gaagattctcctccggagaaagcgcgccttttgcgcgacctgccggagaacggaatcata
agaaaagaatcggaaatccaaaccatgattgagaagttgacgccaagaacctgggggggt
tga

DBGET integrated database retrieval system