KEGG   Thermacetogenium phaeum: Tph_c26440Help
Entry
Tph_c26440        CDS       T02276                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase MalQ
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00500  Starch and sucrose metabolism
tpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tph_c26440 (malQ)
Enzymes [BR:tpz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tph_c26440 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: AFV12812
UniProt: K4LL90
Position
complement(2657963..2660005)
Genome map
AA seq 680 aa AA seqDB search
MAGGSESLLEQLAREYGVEIAYYDTAGRLRKAEPHSLLAVLRCLGAPLESLQDVPAALKE
RREGRWRRRLEPVAVALAGEPPALMLRLREDEAEAPALCELELENGERESWSCRPADLPM
ISRAAVEGVPYTTRQVLLPHLPPGYHRFALSFSSDRSETLVIAAPPQVFDLAADGGKVWG
VFLPLYALRSGRNWGAGDFSDLEALAGWVRGLGGRLVGTLPLLPVFLTQPFDPSPYAPVS
RLFWNEFYLDVTRVPELEQSPAARELLSSPGFQEELRCLREGPLVDYRRGMALKRRILEH
LARFLFSGSTGRRAELEGWTKACPEASDYARFRAVVERRKCGWPEWPLRLREGQLQDGDY
DPAASQYHLYVQWLAKQQLGEVVRRARKAGMGIYLDFPLGVHRLGYDVWREREAFAVDAD
VGAPPDDFLPEGQNWGFPPLHPEGIREQGYRYFISCLRHHLRYAGFLRLDHVMALHRLFW
IPKGLPAKEGVYVRYRAEEFYAILALETCRHGTVLVGEDLGTVSDEVRAAMGRHRVYRMY
VLPFQLNGQGAPGEVPAAALACLNTHDMVPFAAFWEGSSPERRQNLTDFLWRGGWMEKQG
GETERALRACLKYLAASSARILLVNLEDLWLEKNPQNVPGLQGYPNWRRKAQYALEEVMG
MEAVTSVLRELHRIREGGGR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggaggatcggagtctctgctggaacagctcgcccgtgagtacggggtggagatc
gcttattacgataccgcgggccggcttcggaaagccgaaccgcactcactgctggcggtg
ctccgctgtctgggagcccccctggaaagcctgcaggatgtgcccgctgccctcaaggag
cgccgggaggggaggtggcgccgccgtctggaaccggtggccgtggccctggcaggggaa
cccccggccctgatgctgaggctgcgggaggatgaggccgaagccccggccctttgcgaa
ctggagctggaaaacggggagcgggagagctggagctgccggccggcggacctgcccatg
atctctcgggcggcggtagaaggggtgccttatacgaccaggcaggtactgctgccgcat
ctccccccgggttaccaccggtttgccctctccttttcatctgaccgcagcgaaacactg
gtcatcgccgctccccctcaggtgttcgatctggcagcggacggaggaaaggtctggggg
gtgtttctccccctttacgccctgcgttccggccggaactggggtgccggtgatttcagc
gatctggaggccctggccggctgggtgcgggggctgggaggaaggctcgtcggcaccctt
cccctgttgcccgtcttccttacgcagcccttcgatcccagcccctatgccccggtgagc
cgcctgttttggaacgagttctacctggatgtgaccagggttcctgagctggagcagagc
ccggcggcccgggagcttctctcttccccgggatttcaagaggaattgaggtgtttgcgg
gagggccccctggtggactatcgccgcgggatggctttgaagcggcggatcctggagcac
ctggcgcgcttcctcttctcgggaagcaccgggaggcgggccgaactggagggctggacg
aaagcctgcccggaggcctctgattacgcccgttttcgggctgtggtggagcgccggaaa
tgcggttggccggaatggccgctgcggttgcgggaggggcagcttcaggatggcgactat
gaccccgctgcctcgcagtatcacctctacgtccagtggctggccaagcagcagttgggg
gaggtggtgcgccgggcacggaaggcagggatggggatttacctggattttcccctggga
gtccacaggctcggctatgatgtctggcgggagcgggaggcctttgccgtagacgccgat
gtcggcgccccgccggacgactttcttccggaaggccagaactggggattcccccctcta
cacccggaggggatcagggaacaggggtaccgctatttcatctcctgcctgcgccatcat
ctccggtatgccgggttccttcgcctggaccatgtcatggccctgcatcggcttttctgg
atccccaaggggcttccggccaaagagggggtttacgtccgctaccgggccgaggaattt
tacgccatcctcgccctggagacctgcaggcatgggaccgtcctggtgggtgaggacctg
ggcaccgtctccgatgaggtgcgcgccgccatggggcggcaccgggtctaccgcatgtat
gttcttcctttccagctgaacggtcaaggagctcccggggaagtgccggccgcagccctg
gcctgcctgaatacccatgatatggttccctttgccgccttctgggagggcagcagtccg
gagaggcgtcagaacttgacggacttcctgtggcggggcggttggatggagaagcagggt
ggtgaaacggagcgggcactccgggcctgcctgaaatacctggcagccagctctgcccgc
atcctcctggtcaatctcgaagatctctggctggaaaagaatccacagaacgttcccggc
ctgcagggttatcccaactggaggcggaaggcgcagtacgcgcttgaagaagttatgggg
atggaagcggtgacttcggtgttgcgggagcttcaccggatcagggaaggaggcggacgt
taa

DBGET integrated database retrieval system