KEGG   Thermacetogenium phaeum: Tph_c26500Help
Entry
Tph_c26500        CDS       T02276                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tph_c26500 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tph_c26500 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tph_c26500 (trpB)
Enzymes [BR:tpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tph_c26500 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2668368..2669612)
Genome map
AA seq 414 aa AA seqDB search
MEFPDCKGHFGIFGGQFVPETLMPALEELTLAYEEARSDPSFQEELNYYLKDYVGRPTPL
YFAERLTRYLGGAKIYLKREDLNHTGAHKINNTMGQILLARRMGKKRVIAETGAGQHGVA
TATAAAMFGLECAVYMGAEDIKRQELNVYRMRLLGAVVVPVTAGSRTLKDAMNEAIRDWV
TNVENTYYLLGSVGGPHPYPVMVRNFQSVIGREVKEQVLAAEGRLPDFLVACVGGGSNAM
GLFYPFLDDQVQLIGVEAAGRGLDTGKHAATLSAGRPGVLHGALSYLLQDEYGQVLEAYS
IAAGLDYPGVGPEHSFLKESGRARYTTVTDREALDAFQLLSRTEGIIPALESAHAVAQAV
KMAPTLEREKVIVVNLSGRGDKDVPEVAKFLRVEGSGRENVISRCSGEGFTDRV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaattcccggattgtaaggggcattttggcatattcggcgggcagtttgtcccggag
acgctgatgcccgccctggaggaactgacactggcttatgaggaggcgcgcagcgacccc
tcctttcaggaggaactgaattactacctgaaggattatgtgggcaggccgaccccgctc
tactttgcggagaggctgactcgctacttagggggagcgaagatctacctcaagcgggag
gatctcaaccacacaggggcgcacaagatcaataacaccatggggcagattctcctggcc
cggcggatgggaaaaaagcgggtgatcgccgaaacgggcgccggccagcacggggttgct
acggcgaccgccgcggccatgttcgggctggagtgtgccgtctacatgggagccgaggac
atcaaacgccaggagctgaacgtttaccgcatgcggctgctgggcgcggtggtggtgccg
gtgaccgctgggagccgcaccttaaaggacgccatgaatgaggccattcgcgactgggtg
accaatgtggagaacacctattacctgctgggttcggttggggggccgcatccctatccg
gtgatggtcaggaacttccagtcggttatcgggagggaggttaaggagcaggtgctggcc
gcggagggcaggctccccgatttcctggtggcctgtgtgggcggcgggagcaatgccatg
ggccttttttaccccttcctggacgatcaggtgcagctgatcggggtggaggcggcgggg
cgcggcctggatacgggtaagcatgcggccacccttagcgccgggcgcccgggggttctg
cacggggcgctgagctatctgcttcaggacgagtacgggcaggtgctggaggcctactct
atcgccgccgggctggactacccgggggtggggccggagcacagcttcttaaaggaaagc
gggcgggcacggtatacgacggtaaccgaccgggaggccctggatgcctttcagctgctt
tcccggaccgagggaatcattcccgcactggagagcgcccatgccgtagcccaggccgta
aaaatggcacctaccctggagcgggaaaaggtgatcgtggtcaacctgtcggggcggggg
gacaaggatgtgccggaagttgcaaagttcttgagggtcgaggggagtggaagggagaat
gtcatctcaaggtgttcgggagagggctttaccgacagggtatag

DBGET integrated database retrieval system