KEGG   Thermacetogenium phaeum: Tph_c27010Help
Entry
Tph_c27010        CDS       T02276                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tph_c27010 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tph_c27010 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tph_c27010 (thrC2)
Enzymes [BR:tpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tph_c27010 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2718802..2720082)
Genome map
AA seq 426 aa AA seqDB search
MFEDSAFDNERRDFVLGLRCISCGRELAAGPGVYTCPACGPKEGILDVIYDYERIKRTVS
REQVTGSTDYSLFRYLPFLPVRPDTPRPHLRVGWTPLYRPIGLARQLGISRIYVKDDGQN
PTASLKDRASVIAVIKAVEERMTTVACSSTGNAASSLAGNAAAMGLRTFIFVPGRAPQGK
IAQLLIFGANVISVQGSYSDAFRLSSEAIERWGWYNRNAAINPYLVEGKKTVALEIAEQL
GWEVPDWVVVSVGDGCTIAGIWKGFCDLYRVGWIDRLPKLLGVQSTGCSPLADAFRENRP
WCPAEENTLADSIAVGVPRNPEKALRAVRESGGKMVAVPDEEILAAMRLLGRSSGIFAEP
AGAAGLAGLRSLLEKGEIGREEKVVVVVTGNGLKDVKNAIAAAGEPIKVEPSLDRLFDEL
TRRKLV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaagacagcgcttttgacaacgaacggagggattttgttctcgggcttcgctgc
ataagctgcggcagagaattagcagccgggccgggggtgtacacctgcccggcgtgcggt
ccgaaagaaggaatcctcgatgttatctatgattatgagcgtatcaaaagaaccgtttcc
cgggagcaggtgacggggtcgaccgattattccctgttccgctatctgccttttcttccg
gtgcgaccggatacccctcgtccccacctgcgggtcggctggacccccctctaccgtcct
atcgggctcgcccgccagctggggatcagcagaatctacgttaaagacgacggccagaac
ccgaccgcctctttaaaggatagggcttctgtgatcgccgttatcaaggccgttgaggaa
aggatgacgaccgtcgcctgctcctctacgggaaatgcggcttcctctctggccgggaat
gcggcagcaatgggtctccggaccttcatcttcgttcccggcagggctccccaagggaag
atagcacagctgctgattttcggcgccaacgtcatcagcgttcagggttcctacagcgat
gccttccggctgtcatcggaggccattgagcggtggggctggtataacaggaatgccgcc
atcaacccctacctcgtagaggggaagaagaccgttgccctggagatagccgagcagctg
ggctgggaggttcccgactgggtggttgtatctgtaggtgacggctgcaccattgccggg
atctggaagggcttctgcgatctctacagggtcggctggattgacaggctgcctaaactg
ctgggcgtgcagtcaacaggctgcagtccgctggcggacgccttccgagagaacaggccc
tggtgcccggcggaggagaacaccctggcggacagcatcgccgtgggcgtgccgcgcaac
ccggaaaaggccttgcgggcagtgcgggagtcgggaggtaagatggtggcggtgccggat
gaagagattctcgccgccatgcggttgctgggaaggagcagcggtatcttcgccgagccg
gcgggcgcggcgggactggcggggctgcgctctctgctggagaagggggagatcggccgg
gaggagaaggtcgtcgtcgttgttaccggtaacgggctcaaggatgtcaagaacgccatc
gccgccgccggggaacccatcaaagtggagccatctcttgaccggctgtttgacgaactg
acaaggcggaaactggtataa

DBGET integrated database retrieval system