KEGG   Thermacetogenium phaeum: Tph_c29090Help
Entry
Tph_c29090        CDS       T02276                                 

Gene name
manB
Definition
phosphomannomutase/phosphoglucomutase ManB (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tpz  Thermacetogenium phaeum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c29090 (manB)
   00030 Pentose phosphate pathway
    Tph_c29090 (manB)
   00051 Fructose and mannose metabolism
    Tph_c29090 (manB)
   00052 Galactose metabolism
    Tph_c29090 (manB)
   00500 Starch and sucrose metabolism
    Tph_c29090 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    Tph_c29090 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    Tph_c29090 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tph_c29090 (manB)
Enzymes [BR:tpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tph_c29090 (manB)
    5.4.2.8  phosphomannomutase
     Tph_c29090 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2925145..2926518
Genome map
AA seq 457 aa AA seqDB search
MNADIFRQYDIRGHAERDLTDETVRLIGRAFGSYVLEHGKKDVLVGRDNRLSSPRIHHAL
LNGLLSTGCRVIDIGTVVTPILYFAREHWQVEGGVMITGSHNPPEENGFKLACGPGTIYG
KEITHLREMISRGEFRSGAGTLDSKDAAGPYIEMLNEKIRLGPRKLKVAVDCGNGTASLF
AERILQNWGCEVIPLYCSSDGTFPNHHPDPVKTANLTALKSVVLEENADLGVAYDGDADR
IGVVDDRGNVVWGDRLMCLFWREILPRHPGALAIIEVKCSQALVDEVRRLGGKPVFYKTG
HSLIKAKMRETGAVFTGEMSGHMFFADEYYGYDDAFYATGRLLRILSHTEKSLSQLLADI
PHYYATAETRIPCPDKAKFSVVSRLVERFRREYEIIDVDGVRVIFPDGWGLVRASNTQPV
LVARCESRTPEGLRRICTIMKDAIGQNEEVGEFEWEF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgatatctttcgccagtacgatatccgcgggcacgcggaaagggatctcacc
gacgaaaccgtccggctgatcggacgggccttcggaagctatgtcctggagcacggcaaa
aaggacgttctggtgggcagggacaaccggcttagctcgccgagaatccaccatgccctc
ctgaacggactgctgtcaaccggctgccgcgtcatcgacatcggcacggtggtcaccccc
atcctctacttcgccagggagcactggcaggtggaaggaggggtgatgatcaccggcagc
cacaacccccctgaagagaacggcttcaagctggcctgcggaccgggaaccatctacgga
aaggagatcacccacctgagggaaatgatctccagaggggaattccgctccggagccggc
accctggattcaaaggatgccgccggcccctacatagagatgctgaatgaaaagatccgg
ctggggccgcggaaactcaaggtggcggtggactgcggcaacggtacggcctcccttttt
gcggaaaggatccttcagaactgggggtgcgaggtgatccccctttactgcagttcggac
ggaacctttcccaaccaccacccggacccggtgaaaacggccaacctcaccgcactcaaa
agtgtggtgctggaggaaaatgccgacttaggggtcgcctacgacggagacgccgaccgc
atcggggtcgtcgacgatcgggggaatgtggtctggggggacaggctgatgtgcctcttc
tggcgggaaatcctcccccgccatccgggggcactggcgatcatcgaagtgaagtgctcc
caggccctggtagacgaggtgcgcaggttagggggcaaaccggtcttttacaaaaccggg
cattccctgatcaaggccaagatgcgggagaccggagcggtctttaccggggagatgtcg
ggtcatatgttcttcgccgatgaatattatggttatgacgacgccttttatgccacgggg
aggcttttgagaatactctcccatacggagaagtccctttcgcagctgctggcagacatc
ccccactattacgccaccgccgagacccggattccctgtcccgacaaggccaaattctcc
gtggtctcccgcctggtggaaaggttccgcagggagtacgaaatcatcgatgtcgacggg
gtgcgggtgatctttcccgacgggtggggcctggtgcgggcctccaacacccagcccgtt
ctggttgccaggtgcgagtcgcgaacgcctgaggggctgaggaggatctgcaccatcatg
aaggacgccatcgggcaaaacgaagaggtgggtgagtttgaatgggagttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system