KEGG   Truepera radiovictrix: Trad_0181Help
Entry
Trad_0181         CDS       T01254                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tra  Truepera radiovictrix
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Trad_0181
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Trad_0181
Enzymes [BR:tra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Trad_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207887..209410
Genome map
AA seq 507 aa AA seqDB search
MTDALLMIDLKQPRLTPDERAFLGERRVGGVCLFARNVEDRVQLGELTAELRALLGPDVL
IAVDQEGGAVVRVRDVPYPPSMMALGAADDLGLTRKMGAMSARGLRAVGVNVNFAPVADV
NHNPRNPVIAERAFGGDPEAVARHVAAFVAGHQEAGVGAVVKHFPGHGDTDLDSHLELPH
LAADAARLERLELPPFRRAVAAGVAGVMSAHIVLPALDPALPATLSRAVLTGLLRERLGF
DGVIFTDALDMRAIAASFAPAEAALRAVAAGADMALYLGPLKEHEAILRRLEAGLASGEL
DPEAVARARARLRALARRFPVAPAPEAAWEVGDEARLEAAAFRGTVALGELPKLEPGARV
TLVAAAAVAAGGASSAVRAPAEALAAALEGAGVRVTRAFYARGAEGASVLGALAGAELVL
FASTSRTRMEGAELALARAVARAVRPPQRFVHVALWNPYHALDLPGPALLTFGFRGPSAR
AAARALLEGGAPGRLPVALEVARGPYA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgctctgctgatgatcgaccttaagcagccccgcctgaccccggacgagcgc
gcgtttttgggcgagcgccgcgtgggcggcgtctgcctcttcgcccgcaacgtcgaagac
cgcgtgcagctcggtgaactcaccgccgagctgcgcgcgctcctcggcccggacgtgctc
atcgccgtcgaccaggaggggggggcggtggtgcgcgtgcgcgacgtcccctacccgccc
agcatgatggcgctcggcgcggcggatgacctagggctcacccgcaagatgggcgcgatg
agcgcgcgggggttgcgggcggtgggcgtcaacgtgaactttgcaccggtagccgacgtg
aaccacaacccgcgcaacccggtgatcgccgagagggccttcgggggcgacccggaggcg
gtggcgcggcacgtcgccgcctttgtcgcggggcaccaggaggcgggggtgggggcggtc
gtcaagcacttcccggggcacggcgacaccgacctcgactcgcacctcgagctgccgcac
ctcgcggcggacgcggcgcgcttggagcggctcgagctgcccccctttcggcgcgcggtt
gcggcgggcgtcgcgggggtgatgagcgcgcacatcgtgctcccggcgctcgaccccgcg
ctccccgcgacgctctctagagcggtgctgacgggtcttttgcgcgagcgcctgggcttt
gacggggtcatcttcaccgacgccctcgacatgcgggcgatcgccgcgagcttcgccccc
gccgaggcggcgctgcgcgcggtcgccgcgggcgccgacatggcgctctacctgggcccc
ttaaaggagcacgaggcgatcttgcggcggctcgaggcggggctcgcgagcggcgagctc
gaccccgaggccgtggcgagggcccgcgcgcggctgcgggccctcgcgcggcgctttcct
gtcgcgccagccccggaagcggcctgggaggtgggcgacgaggcgcgtctagaggcggcc
gcctttcgcggcaccgtggcgctcggcgagctccccaagcttgagcccggcgcgcgcgtg
acgctcgtggcggccgcggcggtcgccgccgggggggcgagctccgccgtgcgggctccc
gccgaggcgttggcggcggccctcgagggggcgggcgtgcgggtcacgcgggcgttttac
gcgcgcggcgccgaaggggcgtccgtgctcggcgcgctggcgggggccgagctcgtcctc
ttcgcctcgacctcgcggacccgcatggagggggcggagttggcgctcgccagggccgtg
gcgcgcgccgtgaggccgccgcagcgctttgtccacgtcgccctctggaacccgtaccac
gccctcgacctgcccggccccgcgctgctcaccttcgggtttcgcggcccttcggcgcgt
gcggcggcgcgcgcgctgcttgagggcggggcgccggggcggctgcccgtggcgctcgag
gtcgcgcgcggcccgtacgcgtag

DBGET integrated database retrieval system