KEGG   Truepera radiovictrix: Trad_0212Help
Entry
Trad_0212         CDS       T01254                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tra  Truepera radiovictrix
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Trad_0212
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0212
  Lipid metabolism
   00071 Fatty acid degradation
    Trad_0212
  Amino acid metabolism
   00350 Tyrosine metabolism
    Trad_0212
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Trad_0212
   00626 Naphthalene degradation
    Trad_0212
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Trad_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
247231..248259
Genome map
AA seq 342 aa AA seqDB search
MKAALMHAFREPLRVTDVPDPEPPAGGVVIRVGACGVCRSDWHAWMGHDPTIRLPHVPGH
ELAGTVAALGAGVTHWRVGERVTVPFCCGCGRCQTCRAGYPHVCDAEYQPGFTGWGAFAE
YVALPYAEVNLVRLPDALGFVEAASLGCRFMTAFHALTAQGRVQPGEWVAVHGCGGVGLS
AVMIAAALGARVVAVDLDDAKLERARALGAEHVLRSAHPVGAILELTQGGAHVSLDALGS
AATLRNSVRCLRKKGRHVQVGLLLGESRPTALPMGEVIAKELELRGSHGMPAHAYPQMLR
MIAEGTLAPQRLVGKTLTLEEAGAELAAMGRFAPRGVSVIVL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccgccctcatgcacgcctttcgcgaaccgctacgggtgaccgacgtccccgac
ccggagccgccggctgggggcgtcgtgatccgcgtgggcgcctgtggcgtctgccgcagc
gactggcacgcctggatggggcacgaccccaccatccggttgccgcacgtgccggggcac
gagctcgcgggtacggtcgcggcgctcggtgcgggcgtcacgcattggcgcgtgggggag
cgcgtgacggtgcccttctgctgcggctgtgggcgctgccagacctgcagggcggggtac
ccgcacgtgtgcgacgccgagtaccaaccggggtttacggggtggggggcgttcgctgag
tacgtcgcactgccctacgccgaggtcaacctcgtgcgcctgcccgacgctctggggttc
gtcgaggccgccagcctcggttgccgctttatgacggcgtttcacgcgctcaccgcccag
gggcgcgtgcaaccaggcgagtgggtggcggtgcacggctgcggcggggtggggctctcg
gcggtgatgatcgccgcggcgctcggtgcccgggtcgtggcggtcgacctggacgacgcc
aagctcgagcgtgcccgcgcgctcggtgccgagcacgtcctcaggagcgcgcaccccgtc
ggggcgattctcgagctcacccaagggggcgcgcacgtctcgctcgacgctctgggcagc
gccgcgacgctgcgcaactcggtgcgctgcctgcgcaaaaaggggcgacacgtgcaggtg
gggttgctgctcggcgaaagccggcccaccgcgctgccgatgggtgaggttatcgccaaa
gagctcgagctgaggggcagccacggcatgcccgcgcacgcctatccgcagatgctacgg
atgatcgccgagggcaccctggcgccgcagaggctcgtcggtaagacgctcacgttagag
gaggccggcgcggagctcgccgcgatgggccgctttgcgccgcgcggggtgagcgtgatc
gtgttatag

DBGET integrated database retrieval system