KEGG   Truepera radiovictrix: Trad_0212Help
Entry
Trad_0212         CDS       T01254                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tra  Truepera radiovictrix
Pathway
tra00010  Glycolysis / Gluconeogenesis
tra00071  Fatty acid degradation
tra00350  Tyrosine metabolism
tra00625  Chloroalkane and chloroalkene degradation
tra00626  Naphthalene degradation
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0212
  Lipid metabolism
   00071 Fatty acid degradation
    Trad_0212
  Amino acid metabolism
   00350 Tyrosine metabolism
    Trad_0212
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Trad_0212
   00626 Naphthalene degradation
    Trad_0212
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Trad_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 UDPG_MGDP_dh_N 2-Hacid_dh_C Methyltransf_25 3HCDH_N ELFV_dehydrog Methyltransf_11 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADI13352
UniProt: D7CXZ2
Position
247231..248259
Genome map
AA seq 342 aa AA seqDB search
MKAALMHAFREPLRVTDVPDPEPPAGGVVIRVGACGVCRSDWHAWMGHDPTIRLPHVPGH
ELAGTVAALGAGVTHWRVGERVTVPFCCGCGRCQTCRAGYPHVCDAEYQPGFTGWGAFAE
YVALPYAEVNLVRLPDALGFVEAASLGCRFMTAFHALTAQGRVQPGEWVAVHGCGGVGLS
AVMIAAALGARVVAVDLDDAKLERARALGAEHVLRSAHPVGAILELTQGGAHVSLDALGS
AATLRNSVRCLRKKGRHVQVGLLLGESRPTALPMGEVIAKELELRGSHGMPAHAYPQMLR
MIAEGTLAPQRLVGKTLTLEEAGAELAAMGRFAPRGVSVIVL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccgccctcatgcacgcctttcgcgaaccgctacgggtgaccgacgtccccgac
ccggagccgccggctgggggcgtcgtgatccgcgtgggcgcctgtggcgtctgccgcagc
gactggcacgcctggatggggcacgaccccaccatccggttgccgcacgtgccggggcac
gagctcgcgggtacggtcgcggcgctcggtgcgggcgtcacgcattggcgcgtgggggag
cgcgtgacggtgcccttctgctgcggctgtgggcgctgccagacctgcagggcggggtac
ccgcacgtgtgcgacgccgagtaccaaccggggtttacggggtggggggcgttcgctgag
tacgtcgcactgccctacgccgaggtcaacctcgtgcgcctgcccgacgctctggggttc
gtcgaggccgccagcctcggttgccgctttatgacggcgtttcacgcgctcaccgcccag
gggcgcgtgcaaccaggcgagtgggtggcggtgcacggctgcggcggggtggggctctcg
gcggtgatgatcgccgcggcgctcggtgcccgggtcgtggcggtcgacctggacgacgcc
aagctcgagcgtgcccgcgcgctcggtgccgagcacgtcctcaggagcgcgcaccccgtc
ggggcgattctcgagctcacccaagggggcgcgcacgtctcgctcgacgctctgggcagc
gccgcgacgctgcgcaactcggtgcgctgcctgcgcaaaaaggggcgacacgtgcaggtg
gggttgctgctcggcgaaagccggcccaccgcgctgccgatgggtgaggttatcgccaaa
gagctcgagctgaggggcagccacggcatgcccgcgcacgcctatccgcagatgctacgg
atgatcgccgagggcaccctggcgccgcagaggctcgtcggtaagacgctcacgttagag
gaggccggcgcggagctcgccgcgatgggccgctttgcgccgcgcggggtgagcgtgatc
gtgttatag

DBGET integrated database retrieval system