KEGG   Truepera radiovictrix: Trad_0225Help
Entry
Trad_0225         CDS       T01254                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tra  Truepera radiovictrix
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Trad_0225
Enzymes [BR:tra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Trad_0225
Exosome [BR:tra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Trad_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261979..263067)
Genome map
AA seq 362 aa AA seqDB search
MTPPKPQPHAPPNTAPEPHSPLALPRRPRRLRASPALRDLVAETRLAPSDLIAPFFVIAG
SGAEEPIGALPGVSRLSVDRLLRQLERGLELGVRAAVLFGVLGAADKDPRGVRAADPQGP
VARALREARRAFGSDLVLITDVCLCGYTDHGHCGLLKATPRGVVIDNDSSLAALAEMAVT
HAEAGADLVSPSDMMDGRVGYLRGALDRAGFTGVGILAYTVKYASAFYGPFREAAGSAPQ
GGTSPDGMLPPRDRRTYQMDPRNAREGLVETALDEAEGADMLMVKPALAYLDVLWRMRAA
TPLPLAAYHVSGEYAALKAAARAGALDEASAVQESLWAIKRAGADLIITYYALEAAAKGW
LG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgccccccaagccccaaccgcacgccccacccaacaccgcgcccgaaccccacagc
cccctcgccctcccgcggcgcccgcggcggctccgcgcgagccccgcgctgcgcgacctg
gtcgccgagacgcgcctcgcgccgagcgacctcatcgcccccttcttcgtgatcgcgggg
tccggcgccgaagaacccatcggggcgctcccgggggtctcgcgcctcagcgtcgacagg
cttttgcggcagctcgagcggggcctcgagcttggcgtccgcgccgccgtgctcttcggc
gtcctcggtgcggcggacaaagacccccgcggcgtgcgcgcggctgacccccagggtccc
gtcgcgcgggcgctgcgcgaggcgcggcgcgcttttggcagcgacctcgtgttgatcacc
gacgtgtgcctctgcggctacaccgaccacggccactgcgggctcctcaaggcgacgccg
cgcggggtcgtcatcgacaacgactcgagcctcgccgccctagccgagatggccgtgacg
cacgccgaggcgggcgccgacctcgtctccccctcggacatgatggacgggcgcgtcggc
tacctgcgcggcgcgctcgaccgcgccggtttcacgggggtcggcatcttggcctacacc
gtcaagtacgcctcggcgttctacgggcccttccgcgaggcggcgggctcggcgccccag
ggggggacgtcccccgacgggatgctcccccccagagaccgccgcacctaccagatggac
ccccgcaacgcccgcgagggcctcgtcgaaaccgccctcgacgaggccgaaggggcggac
atgctgatggtcaaacccgcgctggcttacctcgacgtcctctggcggatgcgcgccgcg
acccccttgccgctagccgcttaccacgtctcgggggagtacgcggcgctcaaggcggcg
gcgcgcgcgggtgctctcgacgaagcgagcgccgtgcaggagagcctctgggcgattaaa
cgcgcgggcgccgacctgatcatcacctactacgccctcgaggccgccgcaaagggctgg
ctcggctga

DBGET integrated database retrieval system