KEGG   Truepera radiovictrix: Trad_0252Help
Entry
Trad_0252         CDS       T01254                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tra  Truepera radiovictrix
Pathway
tra00010  Glycolysis / Gluconeogenesis
tra00620  Pyruvate metabolism
tra00640  Propanoate metabolism
tra00680  Methane metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0252
   00620 Pyruvate metabolism
    Trad_0252
   00640 Propanoate metabolism
    Trad_0252
  Energy metabolism
   00680 Methane metabolism
    Trad_0252
Enzymes [BR:tra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Trad_0252
Lipid biosynthesis proteins [BR:tra01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Trad_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADI13392
UniProt: D7CY32
Position
complement(294346..296295)
Genome map
AA seq 649 aa AA seqDB search
MASIESVMQEGRRFRPPESFRARAKLKDAADYERLYRQSLDDPEGFWGAVANELHWFKPW
ERVLEWEEPFVKWFVGGQTNLSYNCLDLQVERGRGDKKAILWEGEPGDTRTYTYRELLAE
VSKLANTLKGLGVGKGDKVAIYLPMIPQAVIAMLACARIGAVHSVVFGGFSSAALADRVN
DARAKVIITADGGYRRGSVFALKPLVDEALERCESVEHVIVVRRGENDVQMQPGRDRWYH
ELIESASDVCPAEPMDAEDPLFILYTSGSTGKPKGVLHTTGGYQTYTYLTVKYIFDLRDD
DLYWCPADVGWITGHSYIVYGPLLNGVTQLMYEGVPTHPAPDRHWEMVARYGVTIYYYAP
TAIRAFMKAGEEYPKKHDLSSLRLLGTVGEPINPEAWMWYHRVIGGERCPIVDTWWQTET
GGIMITTLPGVHDTKPGSAGKPFFGVDAAVMDLEGNEQEAGSGGYLVIKRPWPSMLRTVY
GDDDRYRAQYWSEIPHVYFAGDGARRDDEGYFWIMGRVDDVVNVSGHRLGTAEIESALVS
HPAVAEAAVVGRPDEVKGQAIVAFVTLEGKREGSEALYQELRAHVTKEIGAIARPDDIRF
ADALPKTRSGKIMRRLLRNIAAGEEASGDISTLEDKGVVEKLLRPGVSR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatcgaatcggtcatgcaggaggggcgccgctttcgcccgcccgaatcgttt
agagcgcgcgctaaactcaaagacgccgccgactacgagcgcctctaccgccagtcgctc
gacgatcccgaaggcttctggggggccgtggcgaacgagctgcactggtttaaaccctgg
gagcgggtgctcgagtgggaagagccgttcgtcaaatggttcgtgggcggccagacgaac
ctctcgtacaactgcctcgacctgcaggtcgagaggggccgcggcgacaaaaaggccatc
ttgtgggaaggcgagccgggcgacacgcgcacctacacctaccgcgagctcttggccgag
gtctccaaactcgcaaacaccctcaaagggctcggcgtcggcaagggcgacaaggtcgcc
atctacctgcccatgatcccgcaggcggtcatcgccatgctcgcctgcgcccgcatcggc
gcggtccacagcgtcgtcttcggcgggttttcgtcggcggcgctcgccgaccgggtcaac
gacgcgcgggccaaagtcatcatcaccgccgacgggggctaccggcgcgggagcgtcttc
gccctcaaaccgctcgtcgatgaagctttggagcgctgcgagagcgtcgagcacgtcatc
gtcgtgcggcgcggcgagaacgacgtgcagatgcagccggggcgcgaccggtggtaccac
gagctgatcgagagcgcctctgacgtgtgccccgccgaacctatggacgccgaggacccg
ctctttatcctctacacctcgggttcgaccggcaaacccaagggggtgctgcacaccacc
ggcggctaccagacctacacctacctgacggtcaaatacatcttcgacctccgtgacgac
gacctctactggtgcccggccgacgtcggttggatcaccgggcactcgtacatcgtctac
gggccgctcttaaacggcgtgacgcagctgatgtacgagggggttcccacccaccccgcc
cccgaccgccactgggagatggtcgcgcgctacggcgtcaccatctactactacgcgccc
acggccatccgcgcctttatgaaagcgggcgaagagtaccccaaaaagcacgatctctcg
tcgctccggcttttgggcacagtcggcgaacccatcaaccccgaggcgtggatgtggtac
caccgcgtcatcggcggggagcgctgccccatcgtcgacacctggtggcagaccgagacg
ggcggcatcatgatcaccacgctgcccggggtccacgacaccaaacccggttcggccggc
aaaccctttttcggcgtcgacgcggccgtgatggacctagagggcaacgagcaggaggcg
gggagcggcggctacttggtcatcaaacgcccttggccgagcatgctccgcaccgtctac
ggcgacgacgaccgctaccgcgcgcagtactggagcgagatcccgcacgtttacttcgcg
ggcgacggcgcgcggcgcgacgacgaggggtacttctggatcatgggacgcgtcgacgac
gtggtcaacgtctccggccaccgcctcggcaccgccgagatcgagtcggccctggtctcc
cacccggctgtcgccgaggccgccgtggtcggccgccccgacgaggtcaaggggcaggcc
atcgtcgcttttgtcaccttagagggtaagcgcgagggctcggaagcgctctaccaggag
ctgcgcgcgcacgtcaccaaagagatcggcgccatcgcccgcccggatgacatccgcttc
gccgacgcgctgcccaaaacgcgcagcggcaagatcatgcggcggcttctgcgcaacatc
gccgcgggcgaggaggcctcgggcgacatcagcacgcttgaagacaagggcgtggtggag
aagctgctgcggccgggggtgagtagatag

DBGET integrated database retrieval system