KEGG   Truepera radiovictrix: Trad_0253Help
Entry
Trad_0253         CDS       T01254                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tra  Truepera radiovictrix
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trad_0253
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0253
   00620 Pyruvate metabolism
    Trad_0253
   00640 Propanoate metabolism
    Trad_0253
  Energy metabolism
   00680 Methane metabolism
    Trad_0253
Enzymes [BR:tra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Trad_0253
Lipid biosynthesis proteins [BR:tra01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Trad_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296741..298630
Genome map
AA seq 629 aa AA seqDB search
MAKLETLAAHQDEVAPPRAVRERATLQDYEAQYRRSLGDPEGYWAEVAEAFSWVTPWQRV
LEWDGVHHRWFVGATTNITLNALDRHVAAGKKNKLAYLWLGEDGRERALTYGMLLAQVSR
VANGLRRLGVVKGDRVLIYMPLTLEGVIAMLACARIGAVHSVVYAGFAAGALRARIEDAQ
AKVVITGDVGYRRGKRVDLLTIARSAVRPLEFVEHVVVFRREAREAAQGEAPLEGLEVPW
ERLLEEPPHCDAEVVDAEHPLYILYTSGTTGKPKGVVHVHGGYMVGTAHQLRTFYDLDED
DVFWNMSDIGWAVGHSYIAYAPLVNGLTTIFREGAPDTPHPGAAWEIVERYGVTAILTAP
TVVRMWMRYGEEPLRGRHLDTLRLLAVAGEPLNPEAFRWAQTHLMGDHGMVRDNWWQTET
GAPTLGTFPTQAYRPGFVGRPVLGVEAAVLSETGERLPPNEGGLLALTRPFPNLLRTIHG
APERYEAAWLEFPGYYLTGDVAVCDEAGRFSVLGRADDVLSVAGHRIGTADVESALVSHP
AVAEAAVIGVPDELKGEAIVAFVVLRSGQTASPEALTEHVRNELGAIAAPAEVHLVETLP
KTRSGKIMRRLLRAQALGQDPGDTSTLES
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctcgaaacgctcgcagcgcaccaagacgaggtagcgccacctcgagcggtg
cgcgagcgcgccacgctgcaagactacgaggcgcagtaccgccgctcgttaggggacccc
gaaggctactgggccgaggtcgccgaggcgttctcctgggtgacgccttggcagcgggtg
ctcgagtgggacggcgtccaccaccgctggttcgtgggggcaacgaccaacatcaccctg
aacgccctcgaccggcacgtcgcggcggggaagaagaacaagctcgcctacttgtggctg
ggcgaggacggccgtgagcgggcgctcacctacgggatgctgctcgcgcaggtgagccgc
gtcgccaacggcttgaggcgtttgggcgtcgtcaagggcgaccgggtgctcatctacatg
ccgctcaccctagagggcgtcatcgccatgctcgcctgcgcccgcatcggcgcggtccac
agcgtcgtctacgcggggttcgccgcgggcgccctaagggcgcgcatcgaggacgcgcag
gccaaggtcgtgatcaccggcgatgtgggctaccggcggggcaaacgcgtggacctgctc
accatcgcgcggagcgccgttcggccgctcgagttcgtcgagcacgtggtggtctttcgg
cgcgaagcgcgcgaggcggcgcagggtgaggcgcccctagaggggctcgaggtgccctgg
gaacgcctgttggaggagccgccgcactgcgacgccgaagtcgtcgacgccgagcacccg
ctctacatcctctacacctcgggcaccaccggcaaacccaaaggcgtggtgcacgtccac
ggcggctacatggtcggcacggcgcaccagctgcgcaccttctacgaccttgacgaggac
gatgtcttctggaacatgagcgacatcggttgggcggtcggccactcgtacatcgcctac
gcgccgctcgtcaacggcctcaccacgatcttccgcgagggcgcccccgacaccccgcac
cccggcgccgcttgggagatcgtcgagcgttacggcgtcacggcgatcctcaccgccccg
acggtcgtgcggatgtggatgcgctacggcgaggagcccttgcggggccgacacctagac
acgttgcggctcctggcggtcgccggcgaaccgttgaaccccgaagcgtttcgctgggcg
cagacgcacctcatgggcgaccacgggatggtccgcgacaactggtggcagaccgagacg
ggcgcgccgaccctggggaccttccctacgcaggcgtacagacccggttttgtcggacgc
cccgtcctgggggtcgaggcggccgtcttgagcgagacgggcgagcggctgccgcccaac
gagggggggctgctcgcgctgacgcgcccctttcctaaccttttgcgcaccatccacggc
gctccggagcgctacgaggcggcgtggctcgagtttcccggctactacctcacgggcgac
gtcgccgtgtgcgacgaggcgggccgctttagcgtcttgggccgcgccgacgacgtcttg
agcgtcgcggggcaccgcatcggcaccgccgacgtcgagtcggccctggtgtcgcacccg
gctgtcgccgaagcggcggtgatcggcgtccccgacgagctcaaaggggaggccatcgtc
gccttcgtggtgctccgcagcggccagacggcctccccggaggcgctcaccgagcacgta
cggaacgaactgggcgctatcgccgcccccgcggaggttcaccttgtagagaccctaccc
aaaacgagaagcggcaagatcatgcgccgcctgctgagggcgcaggcgctcgggcaggac
ccgggcgacacctcgacgctcgagtcctga

DBGET integrated database retrieval system