KEGG   Truepera radiovictrix: Trad_0253Help
Entry
Trad_0253         CDS       T01254                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tra  Truepera radiovictrix
Pathway
tra00010  Glycolysis / Gluconeogenesis
tra00620  Pyruvate metabolism
tra00640  Propanoate metabolism
tra00680  Methane metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0253
   00620 Pyruvate metabolism
    Trad_0253
   00640 Propanoate metabolism
    Trad_0253
  Energy metabolism
   00680 Methane metabolism
    Trad_0253
Enzymes [BR:tra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Trad_0253
Lipid biosynthesis proteins [BR:tra01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Trad_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADI13393
UniProt: D7CY33
Position
296741..298630
Genome map
AA seq 629 aa AA seqDB search
MAKLETLAAHQDEVAPPRAVRERATLQDYEAQYRRSLGDPEGYWAEVAEAFSWVTPWQRV
LEWDGVHHRWFVGATTNITLNALDRHVAAGKKNKLAYLWLGEDGRERALTYGMLLAQVSR
VANGLRRLGVVKGDRVLIYMPLTLEGVIAMLACARIGAVHSVVYAGFAAGALRARIEDAQ
AKVVITGDVGYRRGKRVDLLTIARSAVRPLEFVEHVVVFRREAREAAQGEAPLEGLEVPW
ERLLEEPPHCDAEVVDAEHPLYILYTSGTTGKPKGVVHVHGGYMVGTAHQLRTFYDLDED
DVFWNMSDIGWAVGHSYIAYAPLVNGLTTIFREGAPDTPHPGAAWEIVERYGVTAILTAP
TVVRMWMRYGEEPLRGRHLDTLRLLAVAGEPLNPEAFRWAQTHLMGDHGMVRDNWWQTET
GAPTLGTFPTQAYRPGFVGRPVLGVEAAVLSETGERLPPNEGGLLALTRPFPNLLRTIHG
APERYEAAWLEFPGYYLTGDVAVCDEAGRFSVLGRADDVLSVAGHRIGTADVESALVSHP
AVAEAAVIGVPDELKGEAIVAFVVLRSGQTASPEALTEHVRNELGAIAAPAEVHLVETLP
KTRSGKIMRRLLRAQALGQDPGDTSTLES
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctcgaaacgctcgcagcgcaccaagacgaggtagcgccacctcgagcggtg
cgcgagcgcgccacgctgcaagactacgaggcgcagtaccgccgctcgttaggggacccc
gaaggctactgggccgaggtcgccgaggcgttctcctgggtgacgccttggcagcgggtg
ctcgagtgggacggcgtccaccaccgctggttcgtgggggcaacgaccaacatcaccctg
aacgccctcgaccggcacgtcgcggcggggaagaagaacaagctcgcctacttgtggctg
ggcgaggacggccgtgagcgggcgctcacctacgggatgctgctcgcgcaggtgagccgc
gtcgccaacggcttgaggcgtttgggcgtcgtcaagggcgaccgggtgctcatctacatg
ccgctcaccctagagggcgtcatcgccatgctcgcctgcgcccgcatcggcgcggtccac
agcgtcgtctacgcggggttcgccgcgggcgccctaagggcgcgcatcgaggacgcgcag
gccaaggtcgtgatcaccggcgatgtgggctaccggcggggcaaacgcgtggacctgctc
accatcgcgcggagcgccgttcggccgctcgagttcgtcgagcacgtggtggtctttcgg
cgcgaagcgcgcgaggcggcgcagggtgaggcgcccctagaggggctcgaggtgccctgg
gaacgcctgttggaggagccgccgcactgcgacgccgaagtcgtcgacgccgagcacccg
ctctacatcctctacacctcgggcaccaccggcaaacccaaaggcgtggtgcacgtccac
ggcggctacatggtcggcacggcgcaccagctgcgcaccttctacgaccttgacgaggac
gatgtcttctggaacatgagcgacatcggttgggcggtcggccactcgtacatcgcctac
gcgccgctcgtcaacggcctcaccacgatcttccgcgagggcgcccccgacaccccgcac
cccggcgccgcttgggagatcgtcgagcgttacggcgtcacggcgatcctcaccgccccg
acggtcgtgcggatgtggatgcgctacggcgaggagcccttgcggggccgacacctagac
acgttgcggctcctggcggtcgccggcgaaccgttgaaccccgaagcgtttcgctgggcg
cagacgcacctcatgggcgaccacgggatggtccgcgacaactggtggcagaccgagacg
ggcgcgccgaccctggggaccttccctacgcaggcgtacagacccggttttgtcggacgc
cccgtcctgggggtcgaggcggccgtcttgagcgagacgggcgagcggctgccgcccaac
gagggggggctgctcgcgctgacgcgcccctttcctaaccttttgcgcaccatccacggc
gctccggagcgctacgaggcggcgtggctcgagtttcccggctactacctcacgggcgac
gtcgccgtgtgcgacgaggcgggccgctttagcgtcttgggccgcgccgacgacgtcttg
agcgtcgcggggcaccgcatcggcaccgccgacgtcgagtcggccctggtgtcgcacccg
gctgtcgccgaagcggcggtgatcggcgtccccgacgagctcaaaggggaggccatcgtc
gccttcgtggtgctccgcagcggccagacggcctccccggaggcgctcaccgagcacgta
cggaacgaactgggcgctatcgccgcccccgcggaggttcaccttgtagagaccctaccc
aaaacgagaagcggcaagatcatgcgccgcctgctgagggcgcaggcgctcgggcaggac
ccgggcgacacctcgacgctcgagtcctga

DBGET integrated database retrieval system