KEGG   Truepera radiovictrix: Trad_0323Help
Entry
Trad_0323         CDS       T01254                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tra  Truepera radiovictrix
Pathway
tra00230  Purine metabolism
tra01100  Metabolic pathways
Module
tra_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Trad_0323
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Trad_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33
Motif
Other DBs
NCBI-ProteinID: ADI13462
UniProt: D7CRH2
Position
374460..375080
Genome map
AA seq 206 aa AA seqDB search
MSAKRSGILFVMTGASGVGKDTIRQAALPDLDNLFFSISATTRARRPGEVHGKQYFFYDK
AAFEALLREDALLEYAEYVGDYYGTPAAPVHEALASGQDVLLELELVGAREVKRRLPEAI
MIFIAPPSLSELERRLRGRGTDSESRIQKRLARAREEIRAVKEFDYVVVNDTLSTAVRDF
CSIIHAERARTKHLSARDIANFLREL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaaacgctccggcatcctgttcgtcatgacgggggcttctggggtgggcaag
gataccatccggcaggcggccttgcccgacctggacaatctctttttctcgatttcggcg
accacccgcgcgcgccgcccgggcgaggtgcacggcaagcagtactttttttacgacaaa
gcggccttcgaggcgctgctgcgcgaggacgcgcttttggagtacgccgagtacgtcggc
gactactacggcacgccggcggcgcccgtgcacgaggcgctcgcgagcggccaggacgtg
ctcttagagctcgagctggtcggtgcgcgcgaggtcaaaaggcggctgcccgaggcgatc
atgatctttatcgccccgcccagtttgagcgagctcgaacgccgcctgcggggccgcggc
accgactccgagtcgcgcatccagaagcgcctcgcgcgcgcgcgcgaggagatccgcgcc
gtcaaggagttcgactacgtggtcgtcaacgacaccttgagcaccgccgtgcgcgacttt
tgcagcatcatccacgccgagcgcgcccgcaccaaacacttgagcgcgcgcgacatcgcc
aactttttgcgcgagctctaa

DBGET integrated database retrieval system