KEGG   Truepera radiovictrix: Trad_0350Help
Entry
Trad_0350         CDS       T01254                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tra  Truepera radiovictrix
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tra00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
398636..399253
Genome map
AA seq 205 aa AA seqDB search
MHQIPPPAPSPLELDDPSPLPEAQALEATVARLIAQLGEDVTREGLQRTPARVARSLRFL
TSGYAQDAQSVVRGALFRAEGAELVVVKGLEFYSLCEHHLLPFFGRVHIGYVPGEHILGL
SKFARVVDVFARRLQVQERLTVQVADALEGVLRPRGVGVVVEASHLCMMMRGVQQQGSST
RTSVLRGVLGDPGVREEFLRAINTP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagattccaccccccgcccccagccccctcgagctcgatgaccccagcccgctc
cccgaagcgcaggcgctcgaggcgaccgtcgcgcgccttatcgcgcagctcggcgaggac
gtcacgcgcgaaggcctgcagcgcacgcccgcgcgcgtcgcgcgctcgctgcgctttttg
acgagcggttacgcccaagacgcccagagtgtggtgcgcggcgcgctctttcgcgccgag
ggcgcggagctcgtcgtggtcaaggggctcgagttctactcgctctgcgaacaccacctg
ctgccctttttcggccgcgtccacataggctacgtgcccggcgagcacatcctgggtctt
agcaagttcgcccgcgtcgtcgacgtgttcgcgcggcgcttgcaggtgcaggagcggctg
acggtgcaggtcgccgacgccctcgagggggtgctgcgcccccgcggggtcggggtcgtc
gtcgaggcgagtcacctctgcatgatgatgcgcggggtgcagcagcagggctcgagcacg
cgcacgagcgtcttgcgcggggtgctcggggaccccggggtgcgggaggagtttctgcgc
gcgatcaacacgccttag

DBGET integrated database retrieval system