KEGG   Truepera radiovictrix: Trad_0356Help
Entry
Trad_0356         CDS       T01254                                 

Definition
succinate dehydrogenase, membrane subunit (SdhD)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tra  Truepera radiovictrix
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trad_0356
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Trad_0356
   00650 Butanoate metabolism
    Trad_0356
  Energy metabolism
   00190 Oxidative phosphorylation
    Trad_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402562..403020
Genome map
AA seq 152 aa AA seqDB search
MAVRAPRTLRDARATYTTNGELAWWVFMRVSGLALIFLTFGHLYMSNIVIDAGQIDFSYV
ARRLSITWVKIYDTLLLGLAVLHGVNGARYSIEDYARHPGWRFGIKMGLYSATVLVMIIG
IISLWAVDYTQYLNLPPDAMPGAAPGAVAPGH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcgcgcaccacggacgctgcgcgacgcgcgcgcgacctacactaccaacggc
gagctcgcttggtgggtattcatgcgcgtgtcggggctcgcgctcatcttcctgaccttc
ggccacctctacatgagtaacatcgtcatcgacgccggtcagatcgactttagctacgtc
gcgcggcggctctcgatcacctgggtcaagatctacgacacgctcctcttggggctcgcc
gtgctccacggggtcaacggcgcgcgctacagcatcgaggactacgcccgccacccgggg
tggcgcttcggtatcaagatggggctctactcggctaccgtgctggtcatgatcatcggc
attatctcgctctgggcggtcgactacacccagtacctcaacctgccgccggacgcgatg
ccgggtgcggcgcctggcgccgtggcgccggggcactag

DBGET integrated database retrieval system