KEGG   Truepera radiovictrix: Trad_0457Help
Entry
Trad_0457         CDS       T01254                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tra  Truepera radiovictrix
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trad_0457
   01230 Biosynthesis of amino acids
    Trad_0457
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0457
   00051 Fructose and mannose metabolism
    Trad_0457
   00562 Inositol phosphate metabolism
    Trad_0457
Enzymes [BR:tra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Trad_0457
Exosome [BR:tra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Trad_0457
  Exosomal proteins of bladder cancer cells
   Trad_0457
  Exosomal proteins of melanoma cells
   Trad_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(501925..502677)
Genome map
AA seq 250 aa AA seqDB search
MKPLIAANWKMHKLPSEVTAWASDFEAALADTDRSRFDLAICAPFTHLSALAAALDGTGV
AVGAQDVSSHAEGAYTGEVSAAMLKDLGVRYVIVGHSERRAYHHEDDALVRGKLERVLES
GMTPILCVGETLQEREGGRAREVTLGQLRGALEGVALGNAGGLVVAYEPVWAIGTGKTAT
DADAQEMCGAIRAALKELLPELGGAVRILYGGSMKGDNAAGLLAQPDIQGGLVGSASLDA
RSLAQIAAAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccctcatcgcagccaactggaagatgcacaaactcccgagcgaggtcaccgct
tgggcaagcgactttgaggcggcgctagcggacaccgaccgcagccgtttcgatctcgct
atctgcgcgccctttacgcacctcagcgcgctcgccgcggcgctcgacggtacgggcgtc
gccgtcggcgctcaggacgtaagctctcacgccgagggggcctacaccggcgaggtctcc
gccgcgatgcttaaagacctcggcgtgcgctacgtcatcgtggggcactccgagaggcgc
gcctatcaccacgaagacgacgcgctggtgcggggcaagctcgagcgggtgctcgaaagc
ggtatgaccccgatcctctgcgtcggtgagaccctgcaggagcgcgaaggggggcgcgcg
cgggaggtgacgctcgggcaactccggggtgcgctagagggggtcgcgctgggcaacgct
ggtgggctcgtggtcgcttacgaacccgtgtgggccatcggcaccggcaagaccgcgacc
gacgccgacgctcaggagatgtgcggcgccatccgcgcggcgctcaaagagctcttgccg
gagctagggggggcggttcgcatcctctacggcggctcgatgaagggcgacaacgccgcc
gggctgctcgcgcaacccgacatccagggcgggctcgtgggcagcgccagcttggacgct
cggtcgctcgcccagatcgccgcggcatgctag

DBGET integrated database retrieval system