KEGG   Truepera radiovictrix: Trad_0557Help
Entry
Trad_0557         CDS       T01254                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tra  Truepera radiovictrix
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Trad_0557
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Trad_0557
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Trad_0557
Enzymes [BR:tra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Trad_0557
Exosome [BR:tra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Trad_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(613364..614860)
Genome map
AA seq 498 aa AA seqDB search
MNRRSFLKGSLAVAAGIGLSKLRALYPGAARAQVIRPDTDFRARNLVFFCYDGFTWEDYG
AARAYAARHQQRTLALERLFALGAAGSMLSSSLTSIVTDSAAASSAWSTGRKVVNGSLSM
FPDGRELTTIMALAKAAGKATGVATTTTATHATPAGFVVSVPGRGAEQDIADLYYDFGLD
VILGGGTRFFRADLREDGRPLFAEFRNRGYDVVENKEALAASSGSKLLGIFANGHLPYEI
DRVHQGVDTPSLADMTRQALRVLSGYGNGFVLQIEAGRIDHSNHATDAAATLWDTLAADD
ALEVVLSFIDRHPDTLLILASDHGTGGGAVYGAGSGYRDSSVQFDNIAKHRASFEYLFSQ
LGEAPEAGEIAEAAREYLDLRLTEGDARRLAAVAAGDEDEIRAPTFSSGAANVLAYLLAN
HDQGINLFWNSSHHTAGPVPVAVYGANSRPAQIGLVDNVHLFTWMTEALGVEHENPTMTE
EEALGILETTSLPDTPVA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggagaagcttcctcaagggctcgctcgccgtcgccgccggtatcggcttgtcg
aagctgcgcgccctctaccccggggccgctcgcgctcaggtgattcgccccgacacggac
tttcgcgcgcgcaacctcgtctttttctgctacgacggctttacctgggaggactacggg
gcggcgcgggcgtacgccgcgcggcaccagcagcgcacgctcgcgctcgagcgcctcttc
gcactgggcgccgccggcagcatgctcagtagcagcctcacgagcatcgtcaccgactcg
gcggcggcctcctcagcgtggagcaccggccgcaaggtggtcaacggctcgctgagcatg
ttccccgacggccgcgaactcaccaccatcatggcgctcgccaaggcggcgggcaaagcc
accggcgtcgccaccaccaccaccgcgacgcacgcgaccccggccgggttcgtggtgagc
gtccccggccgcggcgccgagcaagacatcgccgacctctattacgacttcggcctcgac
gtcatcttggggggcggcacccgctttttccgggccgacctgcgcgaggacggccgtccg
cttttcgccgagtttcgcaaccgcggctacgacgtcgtcgaaaacaaggaggcgctcgcc
gcgagtagcggctcgaagctgctcggcatctttgcgaacggtcacctcccctacgagatc
gaccgcgtgcaccaaggcgtcgacaccccgagcctcgccgacatgacgcgtcaagcgctg
cgggttctttcggggtacggaaacgggttcgtgctgcagatcgaagcggggcgcatcgac
cactccaaccacgccaccgacgccgccgctaccttgtgggacacgctggcggccgacgac
gccctggaggtcgtgctctcgtttatcgaccgccaccccgacacgctgcttatcttggcg
agcgaccacggcacggggggcggggcggtctacggcgcgggcagcggctaccgcgacagc
tcggtacagtttgacaacatcgccaagcatagagcctcttttgagtacctgttctcccag
ctcggcgaagcgccggaggcgggcgagatcgccgaggcggcgcgggagtacctggacctg
cgcctgaccgagggtgacgcccgtcgcctcgcggcggtcgccgccggcgacgaggacgag
atccgcgcccccaccttctcctcgggagcggccaatgtgctcgcgtacctgctcgccaac
cacgaccaggggatcaacctcttctggaactcgagccaccacaccgccggaccggtgccc
gtcgccgtctacggggccaacagccgccccgcgcagatcgggctcgtcgacaacgtgcac
cttttcacctggatgaccgaagcgctcggcgtggagcacgagaacccgacgatgaccgag
gaggaggcgctcggtatcctcgaaaccacgagcctacctgacaccccggtcgcttaa

DBGET integrated database retrieval system