KEGG   Truepera radiovictrix: Trad_0583Help
Entry
Trad_0583         CDS       T01254                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tra  Truepera radiovictrix
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Trad_0583
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Trad_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(640063..641415)
Genome map
AA seq 450 aa AA seqDB search
MNRHVVIVGGGLAGLSAAFFLRRARPELRLTVLEKAPLAGGKIGSSTHGGYTVDWAANGF
LPVPETLDLARALGLAGELQEASPVAAKRFLYREGGLRALPSSPPELLTTPLLLPSQKLR
AALEPLLARRADGEESVYAFVARRFGRGVAEAFAGPFVLGITAGDAGALSLDALFPRLRA
LEREHGSVLLGLLRAQRRAKSAAGTPERLTSFRGGGMSRLTERLRQQLGDCVRTGAEVTA
LRRTATGYEVAWGGERLAADALILAAPAFVAAELLQSVCAEASSLLRSIPYADVTVFGLG
YHRVDVPNPLDGFGFLVPRGEGVRVLGVLYSSSIFPDQAPAGRVLLRVIAGGSLDPDFGG
LSEAAQLEAVRRDLRVTLGVVAEPEWVERVPWPKGIPQYTLGHQERVRRARAALGRFPGL
LLAGNAYDGVGVNDTVRSARDAAQALAETL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcacgtcgtcatcgtcggtggggggctcgcggggctcagcgcggcgtttttt
ctgcggcgagcgcggccggagctgcgcctcacggtccttgaaaaggcgcccctcgcgggc
ggcaagatcggctcgagcacccacgggggctacaccgtcgactgggccgcgaacggcttt
ttgccggtccccgagaccttggacctagcgcgcgcgctcgggctagcgggcgagctgcag
gaggcctcgccggtcgccgccaaacgctttctctaccgggagggggggctgagggcgctg
ccgagttcgccccccgagctgctcaccacgcccctgctactcccctcacagaagctgcgc
gcagcgttggagcccctcctcgcgcggcgcgccgacggcgaggagagcgtctacgcgttt
gtggcgcggcgcttcgggcgcggcgtcgccgaggcgttcgcggggcctttcgtcctcggc
atcaccgccggggacgcgggggcgctcagcctcgacgccctctttccgcgcctgcgggcg
ctcgagcgcgagcacggcagcgtcctgctcgggctcctgcgcgcgcagcggcgcgccaag
agcgcggcgggtacaccagagcgcctcacgagctttcgcgggggggggatgagccgcttg
accgagaggctgcgccagcagttgggggactgcgtgcgcacgggcgcggaggtcaccgcg
ctccgccgcaccgcgacggggtacgaggtcgcctggggcggcgagcgcttggccgccgac
gcgctcatcctggccgcgccggctttcgtcgcggccgagctcctccaaagcgtttgcgcc
gaggcgagctccctgctgcgcagcatcccctacgccgacgtcaccgtcttcggcctcggc
taccaccgcgtcgacgtccccaaccccctagacggcttcggtttcctcgtcccgcgcggc
gaaggggtgcgcgtcttgggcgtgctctacagctcgtcgatcttccccgaccaggcgccc
gcgggccgggtgctgctgcgcgtcatcgccgggggcagcctcgaccccgacttcgggggg
ctctccgaggcggcgcagctcgaggcggttcggcgcgacctgcgcgtgaccttgggggtc
gtcgccgaacccgagtgggtcgagcgcgtgccgtggcccaaggggatcccgcagtacacc
ctcgggcaccaggagcgcgtccggagggcgcgcgcggcgctagggcgctttcccgggctc
ctgctcgccggtaacgcctacgacggcgtcggcgtcaacgacaccgtgcggagcgcgcgc
gacgcggcccaggcgctcgccgagaccctctag

DBGET integrated database retrieval system