KEGG   Truepera radiovictrix: Trad_0604Help
Entry
Trad_0604         CDS       T01254                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tra  Truepera radiovictrix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Trad_0604
Enzymes [BR:tra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Trad_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
666691..668244
Genome map
AA seq 517 aa AA seqDB search
MERAAGLLLHPTSLPGGHGIGDLGAAAYRWVDFLAAAEQHLWQVLPLGPTGYGDSPYQSF
SAFAGNPYLISLDKLVEAGLLAASALADAPAFPEGRVDYGQVIPFKLELLSRAFEHFRAH
ASPSQEASFERFCEAQRYWLDDYARFMALKDHHDGRPWNAWDEDLRTRKKRALARFEAEH
EDAVLRYKVWQWMFYEQWFALRLYANEKGIKIIGDIPIFIAFDSADAWANPELFYFDKAG
NPEVVAGVPPDYFSATGQRWGNPLYRWKKMEKRGFAWWIARFRSSLDFYDLIRVDHFRGF
ESYWEIPAEEPTAERGRWVKGPGQALFDALKAALGELPIIAEDLGIITPEVEKLRDDNAL
PGMKVLQFAFAADGADPYLPHNYTRNCVVYTGTHDNDTTLGWYRSAPEAERDFVRRYLGR
DDSAVPWELIRLAYGSVAKYAIIPLQDVLSLGSEARMNTPGAAQGNWSWRLREGQLAPWV
APALAEMAATYGRVPGQEPEDTPYRQSATEAEVGAPR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgcagctggactcctgttacaccccacgtcgctccccggcgggcacggtatc
ggcgacctgggcgccgcagcgtaccgctgggtcgactttttggcggccgccgagcagcac
ctctggcaggttcttccattagggccgaccggttacggcgactccccctaccagagcttt
agcgcctttgccggcaacccttacctgatcagcctggacaagctcgtcgaggcggggttg
ctggcggcgagcgcgctcgccgacgcgcccgcattccccgaggggcgcgtggactacggc
caggtcatcccctttaagctggagcttctgagccgcgccttcgagcactttcgcgcgcac
gccagcccctcgcaggaggcgtcgttcgagcgcttttgcgaggcgcagcgctactggctc
gacgactacgcgcgctttatggcccttaaagaccaccacgatgggcggccctggaacgcc
tgggacgaggacctaaggacgcggaaaaagcgggccttggcgcgttttgaggccgagcat
gaagacgccgtgctgcgctacaaggtctggcagtggatgttttacgagcagtggtttgcg
ctgcggctctacgccaacgaaaagggcatcaagatcatcggcgacatccccatctttatc
gccttcgactccgccgacgcgtgggcgaaccccgagctcttctacttcgacaaagccggt
aaccccgaggtggtcgcgggcgtgccgcccgactactttagcgccacggggcagcgttgg
ggcaaccccctctaccgctggaaaaagatggagaagcgcggcttcgcctggtggatcgcg
cgctttcgctcgtcgctcgacttttacgacctcatccgcgtcgatcacttccggggcttc
gagtcgtactgggagatcccggccgaggagccgacggcggagcgtgggcgctgggtcaaa
ggccctggccaagccctcttcgacgccctcaaggcggcgctcggcgagctccccatcatc
gccgaggacctgggcatcatcacgccggaggtcgaaaagctgcgcgacgacaacgctttg
cccggcatgaaggtgttgcagttcgcctttgccgccgacggcgccgacccctacttgccg
cacaactacacgcgcaactgcgtcgtctacacgggtacccacgacaacgacaccacgctc
gggtggtaccgcagcgcgccggaggccgagcgcgactttgtgcggcgctacttagggcgc
gacgacagcgccgtgccgtgggagctcatccgcctggcctacggctcggtcgccaagtac
gccatcatccccctgcaagacgtcctctcgctgggttcggaggcgcgcatgaacaccccc
ggggcggcgcagggcaactggagctggcgcctgcgtgaggggcagctcgcgccgtgggtc
gctccggcgctcgcggagatggccgcgacctacggccgcgtgccggggcaggagcccgag
gacacgccctaccggcagtcggccaccgaggccgaggtgggggcgccgcgctag

DBGET integrated database retrieval system