KEGG   Truepera radiovictrix: Trad_0673Help
Entry
Trad_0673         CDS       T01254                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
tra  Truepera radiovictrix
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trad_0673
   01230 Biosynthesis of amino acids
    Trad_0673
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0673
  Energy metabolism
   00680 Methane metabolism
    Trad_0673
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trad_0673
Enzymes [BR:tra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Trad_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740167..740799
Genome map
AA seq 210 aa AA seqDB search
MLELWLIRHGETDWNREGRIQGQQHNPLSALGELQARRLGGRLMGERFDIVYCSDLRRAV
QTAELALPGVPLTLDERLREISRGTLEGHLGAELVGEAKDVYAQMQRDLINVRPPQGENY
RDLSVRAVAWLESLPARGKVAAVTHGGVIYALLHHIVGAHEGATWRFTASNAGITRLHIH
NGRTTLVSVNDTAHLEPQADLRVARQPLVT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctagagttgtggctgattcggcacggtgaaaccgactggaaccgtgaggggcgcatt
cagggtcagcagcacaacccactaagcgccctcggggagctccaggcgcgccgtttgggg
gggcgcctcatgggggagcgcttcgacatcgtctactgctccgacttaaggcgcgccgtg
cagacggcggagctcgccctgcccggcgtccccttgacgctcgacgagcgcctgcgcgag
atctcgcgcggcaccctcgaggggcacctgggtgccgagctcgtcggggaggcgaaggac
gtctacgcgcagatgcagcgcgacctgatcaacgtgcgcccgccgcagggggagaactac
cgcgacctcagcgtgcgggcggtggcgtggcttgagagcctgcccgcgcgcggcaaggtc
gccgccgtgacgcacggcggggtgatctacgcgctgctgcaccacatcgtcggggcccac
gaaggcgcgacctggcgctttaccgcgtcgaacgcggggatcaccaggctgcatatccac
aacgggcgcacgacgctcgtcagcgtcaacgacaccgcacacctcgagccccaagctgac
ctgcgcgtcgcgaggcagccgctcgtcacgtga

DBGET integrated database retrieval system