KEGG   Truepera radiovictrix: Trad_0673Help
Entry
Trad_0673         CDS       T01254                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
tra  Truepera radiovictrix
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
740167..740799
Genome map
AA seq 210 aa AA seqDB search
MLELWLIRHGETDWNREGRIQGQQHNPLSALGELQARRLGGRLMGERFDIVYCSDLRRAV
QTAELALPGVPLTLDERLREISRGTLEGHLGAELVGEAKDVYAQMQRDLINVRPPQGENY
RDLSVRAVAWLESLPARGKVAAVTHGGVIYALLHHIVGAHEGATWRFTASNAGITRLHIH
NGRTTLVSVNDTAHLEPQADLRVARQPLVT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctagagttgtggctgattcggcacggtgaaaccgactggaaccgtgaggggcgcatt
cagggtcagcagcacaacccactaagcgccctcggggagctccaggcgcgccgtttgggg
gggcgcctcatgggggagcgcttcgacatcgtctactgctccgacttaaggcgcgccgtg
cagacggcggagctcgccctgcccggcgtccccttgacgctcgacgagcgcctgcgcgag
atctcgcgcggcaccctcgaggggcacctgggtgccgagctcgtcggggaggcgaaggac
gtctacgcgcagatgcagcgcgacctgatcaacgtgcgcccgccgcagggggagaactac
cgcgacctcagcgtgcgggcggtggcgtggcttgagagcctgcccgcgcgcggcaaggtc
gccgccgtgacgcacggcggggtgatctacgcgctgctgcaccacatcgtcggggcccac
gaaggcgcgacctggcgctttaccgcgtcgaacgcggggatcaccaggctgcatatccac
aacgggcgcacgacgctcgtcagcgtcaacgacaccgcacacctcgagccccaagctgac
ctgcgcgtcgcgaggcagccgctcgtcacgtga

DBGET integrated database retrieval system