KEGG   Truepera radiovictrix: Trad_0706Help
Entry
Trad_0706         CDS       T01254                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tra  Truepera radiovictrix
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Trad_0706
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Trad_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
774594..775493
Genome map
AA seq 299 aa AA seqDB search
MIVVVGSLNMDLVVRVPRAPRPGETLLGSGYETHPGGKGANQAVAAARFGAPVRMVGRVG
RDAYGDPLAHRLAAEGIDLGFLEQTDDKTGVAFITVDEAGQNSIIVAPGANAALRPEDLT
ERVFEGAEVVLVQLEIPLKTALRAAALGRAAGARVLLNLAPAQALSAAQLGDVDLLLVNE
HEAATLLGAPEVLGDLGAALAGLRRFVPAVVLTLGGRGAAWAGPEGSGLEPAHRVRVVDT
TAAGDAFAGALAAELARGATLEAAVRYAGAAGALAVSRSGAQPSLPTREEAERLLRGAG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtcgtcggcagcctcaacatggacctcgtcgttcgcgttccgcgcgccccg
cgccccggtgagacgctcctggggtcggggtacgagacgcaccccggcggcaagggggcg
aaccaggcggtcgcggcggcccgcttcggcgcccccgtgcggatggtcgggcgcgtgggg
cgcgacgcttacggcgacccgctcgcgcaccgcctcgcggccgagggcatcgacctgggt
tttttggagcagacggacgacaagacgggggtcgcttttatcaccgtggacgaggcgggg
cagaacagcatcatcgtggcgccgggggcgaacgcggcgctgcggcccgaggacctcacc
gaaagggtgttcgagggcgccgaggttgtcctcgtccagctcgagatccctctaaagacc
gccctgcgcgccgctgcgctaggccgtgcggcgggggcgcgcgtccttctgaacctcgcg
cccgcgcaggcgctgagcgcggcgcagctcggcgacgtcgacctgctcttggtcaacgag
cacgaagcggcgacgctgctcggcgcgcccgaggtgctcggggacttgggggcggcccta
gcggggctccggcgctttgtcccggcggtcgtgctgacgctcggggggcgcggcgcagct
tgggcggggccggaagggagcgggctcgagcccgcgcacagggttcgcgtcgtcgacacc
acggcggcgggggacgccttcgcgggggcgctcgccgccgagctggcgcggggggcgact
ttggaggcggcggtgcgctacgcgggggcggcgggggcgctcgcggtgagccgttcgggg
gcgcagccctcgctgccgacgcgcgaggaggccgagcggctgctgcggggcgcgggctga

DBGET integrated database retrieval system