KEGG   Truepera radiovictrix: Trad_0762Help
Entry
Trad_0762         CDS       T01254                                 

Definition
hypothetical protein
Orthology
K01934  
5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
tra  Truepera radiovictrix
Pathway
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Trad_0762
Enzymes [BR:tra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     Trad_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828863..829468
Genome map
AA seq 201 aa AA seqDB search
MSSAAPPDPPTPGPVRDWVWGRLLAARQVAYPLPPHGHHPNFKGAAEAAARLLEHLFQTA
RLRPGDTVLAYPDYVLRPLRQRLLEAGVSVVVPAQHGPHYRRLESGVVDARAASSIAGAE
RQGELLTALPDPALLRLSLVACVAVSVRGEVLSKGYGFSLPPETHHLSAATIVHPLQVLG
ALQGDRPGVALYATPEAVREV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgtctagcgccgcaccccccgaccccccgacgcccggccccgtgcgcgactgggtgtgg
gggcggcttttggcggcgcggcaggtcgcttatccgctccccccgcacgggcaccacccc
aacttcaagggggcggcggaagcggccgcgcgcctgctagaacaccttttccagacggcg
cggctccgccccggggacaccgtgctcgcctaccccgactacgtgctgagacccttgcgc
cagcgcctcttggaggccggggtcagcgtcgtggtccccgcgcagcacggcccccactac
cgacgcctcgagagcggggtggtcgacgcgcgcgcggcctcgagtatcgccggggcggag
cgtcaaggggagctcctcacggcgctaccggaccccgcgctgctacgcctgagcttggtg
gcctgcgtcgcggtgagcgtgcgcggcgaggtgctgagcaagggttacggcttttcgctg
ccgcctgagacccatcacctgagcgcagcgacgatcgtgcaccccctgcaggtgctcggc
gcgctccagggagaccgtccgggggtagcgctctacgctacgccggaggcggttcgcgag
gtgtag

DBGET integrated database retrieval system