KEGG   Truepera radiovictrix: Trad_0895Help
Entry
Trad_0895         CDS       T01254                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tra  Truepera radiovictrix
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ADI14029
UniProt: D7CUN8
Position
960368..961435
Genome map
AA seq 355 aa AA seqDB search
MVDNMVDSMDSSVALDMELLKQLSEVGGVPGREERVRALLRGALEGHVDSLEEDALGNLV
AVKTSKKKKAKRVMLSAHMDEIGFYVRFVDDAGFLRVHNVGGFDTRNLFARAVTVHAKEG
DLIGVLNPAVKPVHLSTPEERKKVPELAEFAVDLGLSAEEVRARVRLGDPVTLRQPFVDL
GAVVTGKALDDRVNCFILAQLLRQLDKPSHHVCAVFSVQEEVGLRGATTSAYALEPDIGI
ALDTTLAVDTPGAPPEGRVTQLGGGVALKVMDSASISTRWLLDAFAALAEERGVPYQLEV
LPLGGTDAGAIQRSRKGVATLTLSIPSRYVHTVTEMVAKRDVEASLALLKAYLQG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggtggacaacatggtggacagtatggacagtagcgtggcgctcgacatggagctttta
aagcagctctccgaggtcggcggcgtgccggggcgtgaggagcgggtgcgcgcgcttttg
cggggggccctggaggggcacgtagacagcctcgaggaggacgccttgggcaacctcgtg
gcggtcaaaacgtccaaaaagaaaaaggccaagcgggtgatgctgagtgcgcacatggac
gagatcggcttctacgtgcgctttgtggacgacgcgggttttttgcgcgtgcacaacgtc
ggcggtttcgacacccgcaacctcttcgcgcgggctgtgacggtccacgcgaaggagggc
gacctcatcggggtgctcaacccggcggtgaaaccggtgcacctctccacccccgaggag
cgcaaaaaggtgccggagctcgccgagttcgccgtggacctaggcctcagcgcggaggag
gtgcgcgcgcgtgtgcgcctgggcgatcccgtgacgctgcggcaaccgttcgttgacctc
ggcgcggtcgtcaccggcaaggcgctcgacgaccgcgtcaactgctttatcctggcgcag
ctgctacggcagctcgacaaacccagccatcacgtttgcgccgtctttagcgtgcaggag
gaggtggggttgcgcggcgccacgacgagcgcctacgcgctcgagcccgacatcgggatc
gcgctcgacaccacgctcgccgtggacacccccggcgcgccccccgaggggcgggtgacg
cagctgggcggcggcgtggcgctcaaggtcatggactcagccagcatcagcacccgctgg
ctgttagacgccttcgcggcgctcgcggaggagcgcggcgtgccctatcagctcgaggtc
ctgcccctaggcggcaccgacgcgggggcgatccagcgctcgcgcaaaggcgtcgccacg
ctcaccctgtcgatcccctcgcgctacgtccacaccgtgacggagatggtcgccaagcgc
gacgtcgaggcgtcgctcgcgctgcttaaggcgtacctgcaggggtag

DBGET integrated database retrieval system