KEGG   Truepera radiovictrix: Trad_0898Help
Entry
Trad_0898         CDS       T01254                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tra  Truepera radiovictrix
Pathway
tra00020  Citrate cycle (TCA cycle)
tra00310  Lysine degradation
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Module
tra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Trad_0898
  Amino acid metabolism
   00310 Lysine degradation
    Trad_0898
Enzymes [BR:tra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Trad_0898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: ADI14032
UniProt: D7CUP1
Position
966111..967469
Genome map
AA seq 452 aa AA seqDB search
MAIELKVPEVGESITEVFIGTWLKEEGETVEKDEALVEVETDKATLEVPAPSAGTLSKVL
KKQGESATVGEVIAHISAAGEAEAPAPTPAEAEAAPDDEAAPAADAAPRATDAKEAPEMA
FDPKPSEAIDAQAGAQAAGDRAAEPLGGHVMPAAQRLLDEHGVKARDVRATGPGGRLLKE
DVQRYLEARQAAPLTQAPTKEAPAREAPPKREAPAPEGDRQEEAVPMSPLRRRIAERLVE
AQRTAALLTTFNEVDMSAVMALRSEFKEAFQERYEGTRLGFMSFFVKATIDALKLIPELN
AEIRGTDIVYKNYFDIGVAVSSKKGLIVPVIRNAERLSFAEIERTIADFAKRSQSNKIAP
EELQGGTFTITNGGVFGSLMSTPIVNPPQSGVLGMHGIFERPIALKGEVVIRPMMYIALT
YDHRIVDGREAVTFLKRIKEAIENPARMLLEV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaactgaaagtccccgaggtcggcgaatcgatcaccgaggtctttatcggt
acctggcttaaagaggagggggagacggtagagaaggacgaggcgttggtcgaggtcgag
accgacaaagcgaccctcgaggtccccgcgccgagcgccggcaccttgagcaaggtcctt
aaaaagcagggcgagagcgcgacggtcggtgaggtgatcgcgcatatcagcgccgctggg
gaggctgaggcgcccgccccgacccccgccgaggccgaggcggcgccggacgacgaggcc
gcccccgccgccgacgccgccccgagggcgacggacgccaaagaggcccccgagatggcc
ttcgatcccaaaccgagcgaggcgatcgacgcgcaggcgggcgcgcaagccgcaggtgac
cgcgcggccgagccgctgggcggccacgtgatgcccgccgcgcagcgccttctcgacgag
cacggcgtcaaggcccgcgacgtgcgcgccacgggtcccggcgggcggctcctcaaagag
gacgtgcagcgctacctcgaggcgcgccaagctgcgccgctcacccaagcgccgaccaaa
gaggcgcccgccagggaggcgccgcccaagcgcgaggcgcccgcgccggagggcgaccgc
caagaggaagccgtaccgatgagcccccttcgccgccgcatcgccgagcgcctcgtcgag
gcgcagcggacggcggcgctcctaaccacctttaacgaggtcgacatgagcgcggtgatg
gctctgcgcagcgagttcaaggaggcgtttcaggagcgctacgaggggacgcgcctaggc
tttatgtcgtttttcgtcaaggcgaccatcgacgcgcttaagcttatccccgagctcaac
gccgaaatccgcgggaccgacatcgtctacaagaactacttcgatatcggcgtggcggtg
agctccaaaaagggccttatcgtccccgtgattcgcaacgccgagcgcctcagcttcgcc
gagatcgagcgcaccatcgccgacttcgccaagcgttcgcagagcaacaagatcgccccc
gaggagctgcagggcggcacctttacgattaccaacggcggggtgttcggctccttgatg
tcgacccccatcgtcaacccgccgcagtcgggggtgttgggaatgcacggcatcttcgag
cggcccatagccctcaaaggcgaggtggtgatccgcccgatgatgtacatcgcgctgacc
tacgaccaccgcatcgtcgacgggcgcgaagcggtgaccttccttaaacgcatcaaagag
gccatcgagaaccccgcgcggatgcttctagaggtctag

DBGET integrated database retrieval system