KEGG   Truepera radiovictrix: Trad_0984Help
Entry
Trad_0984         CDS       T01254                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tra  Truepera radiovictrix
Pathway
tra00900  Terpenoid backbone biosynthesis
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01130  Biosynthesis of antibiotics
Module
tra_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Trad_0984
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Trad_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADI14113
UniProt: D7CV85
Position
1061660..1062487
Genome map
AA seq 275 aa AA seqDB search
MTVQLTAHAKVNLGLSLLGRRGDGFHEIDTVMVRLDLGDQLTVALGAPGVRLRVAGAELG
IPPEENLVYRAAEAYLGACSSACGVDLTLVKHLPAAAGLGGGSSDAGATLRALAQLRPAA
VDLAALAAALGSDVPFFARDLPAARATGRGEVLTPLELPPLHLVLANPGVAVSARDAYGY
VARYGGPLDVPALVAGLARYEPDYPNDLEPGVIARVPVVGEVLAALRGAGLRGVRMSGSG
STCFGLATSAAAAARAAADLARAHPAWWVRAAKTG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgcagctcaccgcccacgccaaggtcaacctcgggctctcgctcctggggcgg
cgcggcgacggttttcacgagatcgacaccgtgatggttcgcctcgacctcggcgaccag
ctcaccgtcgctctgggcgcgccgggggtgcggctgcgcgtcgcgggtgcggagctcggc
attccgccggaggagaacctcgtctaccgcgccgcggaagcctatctgggggcgtgctcg
agcgcgtgcggggtcgacctcaccctcgtcaaacacctccccgccgccgctgggctcggg
ggcggttcgtcggacgcgggcgcgacgctgcgggcgctcgcgcagttgcgccccgccgcg
gtcgacctcgctgcgctcgccgccgcgctcggctcggacgtgccctttttcgcccgcgac
ctgccggcggcgcgcgcgacggggcgcggcgaggtgctgacgccgctcgagctccccccg
ctgcacctggtgctcgcgaaccccggcgtggcggtgagcgcccgcgacgcctacggctac
gtcgcgcgttacggcggcccgctcgacgtccccgcactggtagcggggttggcgcgctac
gagccggactaccccaacgacctcgagcccggcgtcatcgcgcgtgtgccggtcgtcggg
gaggtgctcgcggcgcttcggggggcagggctacgaggcgtgcggatgtcggggtcgggt
tcgacgtgttttggcctcgctacgagcgcggcggcggcggcgcgcgccgccgccgacctc
gcgcgcgcccatccggcgtggtgggtgcgcgccgccaagaccggctaa

DBGET integrated database retrieval system