KEGG   Truepera radiovictrix: Trad_1002Help
Entry
Trad_1002         CDS       T01254                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tra  Truepera radiovictrix
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tra01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tra00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1085486..1086361
Genome map
AA seq 291 aa AA seqDB search
MKAFTPSDAPAGALAGDALAEALPAPLGAEQAAAVPGVLGRIAAERVAAYAGADVPLQEL
SVPQRPPFAAALRAPGLSLIAEVKRKSPSQGEIAPLEPAAAASAYARGGAAAISVLTEPA
HFGGALEHLEAVAKAVSLPLLRKDFTVHPAQLVEARRAGASAALLIVAVLGALTGPYLRF
TEALGLDALVEVHSERELELALAVGAQLIGVNNRDLTTLQIDLATAPRLMARARASGFTG
LLVAESGYRDVAELDAVRDLADAVLIGSSVAGSGDLSGAVRRFVAAGGVGG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggctttcacaccttctgacgcgcccgctggcgcgctcgccggtgacgcgctcgcc
gaggcgctccccgcgcccctcggcgccgagcaggcggcggcggtgccgggtgtgctcggc
cgcatcgcggcggagcgggtggcggcctacgcgggcgcggacgtgccgctgcaggagctc
agcgtcccgcagcgcccccccttcgcggcggcgctgcgcgcgcccggcctgagcctcatc
gccgaggtcaagcgcaagagcccgtcacaaggggagatcgccccgctcgagcccgccgcg
gcggcgtccgcgtacgcccgcggcggcgcggcggctataagcgtcctcaccgaacccgcg
cacttcggcggcgcgctcgagcacctggaggcggtcgccaaggccgtctcgctgccgctg
ttgcgcaaggacttcaccgtgcaccccgcgcagctcgtcgaggcgcggcgcgccggcgcg
agcgccgcgctcctcatcgtggccgtcttgggggcgctgacggggccgtacctgcgcttt
accgaggcgctcggcctagacgccctcgtcgaggtgcatagcgagcgcgagctcgagctt
gccttggcggtgggcgcgcagctcatcggggtgaataaccgcgacctcacgaccctgcag
atcgacctcgcgaccgcccccaggctgatggcgcgggcgcgcgcgtcggggtttacgggg
ctcctggtcgccgagtcgggctaccgcgacgtggctgagctggacgccgtgcgcgacctc
gccgacgccgtgctgatcggcagcagcgtggcggggagcggcgacctctcgggggcggtg
cgccgcttcgtggcggcgggtggcgtcggtggctag

DBGET integrated database retrieval system