KEGG   Truepera radiovictrix: Trad_1259Help
Entry
Trad_1259         CDS       T01254                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tra  Truepera radiovictrix
Pathway
tra00020  Citrate cycle (TCA cycle)
tra00640  Propanoate metabolism
tra00660  C5-Branched dibasic acid metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Module
tra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Trad_1259
   00640 Propanoate metabolism
    Trad_1259
   00660 C5-Branched dibasic acid metabolism
    Trad_1259
Enzymes [BR:tra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Trad_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADI14382
UniProt: D7CWI3
Position
complement(1354476..1355699)
Genome map
AA seq 407 aa AA seqDB search
MNIHEYQAKELMQARGVAVPQGAVARTVEEAVAAVRPLVEATGNPVVVLKSQIHAGGRGK
GRFKEHPEVAGVNVITDGLKGGVRATEERVRELAKAMLGSTLVTVQTGESGKQVNRLYIE
QGIDIGRELYLSVVLDRAVGRNVMMASTEGGVEIEEVAERSPEKILREHIDPLVGLANFQ
AARLAHGLGLTGDALKNGVRFMRALAKAAEELDTDMIEINPLVVTKQGQVMALDGKMSFD
NNALFRHKMVAEMRDTSEEDPAELEASNYGLSFIKLDGTIGCLVNGAGLAMATMDIIKHV
GGEPANFLDVGGGATTENVTAAFKIITKDPNVRGIFVNIFGGIMKCDTIANGVVEAVRQV
GLEVPLVVRLEGTNVDLGKRIIDESGLNVVSAKDMKDGAQKIVELAK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatccacgagtaccaagccaaggaactgatgcaggcgcgcggcgtcgccgtgccg
cagggggcggtcgcccgcacggtcgaggaggccgtggcggcggtgcgcccgctcgtcgag
gcgacaggcaacccggtcgtggtgctaaagtcgcagatccacgcgggcgggcgcggcaag
ggccgctttaaagagcaccccgaggtcgccggcgtcaacgtcatcaccgacggcttaaag
ggcggcgtgcgcgctaccgaggagcgggtgcgcgagctcgccaaagcgatgctcggttcg
accctcgtcacggtgcagaccggtgagagcggcaaacaggtcaaccgcctctacatcgag
caggggatcgacataggccgcgagctctacctctcggtggtgctcgaccgtgcggtcggc
cgcaacgtcatgatggcctccaccgagggcggcgtggagatcgaagaggtcgccgagcgc
tcgcccgaaaagatcctgcgcgagcacatcgacccgctcgtcgggctcgctaactttcag
gccgcccgcctcgcccacggcctcggcctcaccggcgacgccctcaaaaacggggtgcgc
tttatgcgcgcgctcgctaaagccgccgaagagctcgacaccgacatgatcgagatcaac
cccttggtcgtcaccaaacaggggcaggtgatggccctagacggcaagatgagcttcgac
aacaacgccctgtttcggcataagatggtcgccgagatgcgcgacacctccgaggaggac
cccgcggagctcgaggccagcaactacgggctctcgtttatcaagctcgacggcaccatc
ggctgcttggtcaacggtgcggggctcgccatggccacgatggacatcatcaagcacgtc
ggcggcgaacccgccaactttttggacgtcggcggcggggcgaccaccgaaaacgtcacg
gcggcctttaagatcatcacgaaagaccccaacgtcaggggcatcttcgtcaacatcttc
ggcggcatcatgaagtgcgacaccatcgccaacggcgtcgtcgaggcggtgcggcaagtc
gggctcgaggtccccttggtggtgcgtttagagggcaccaacgtcgacctcggcaaacgg
atcatcgacgagtcggggctgaacgtcgtgtcggccaaggacatgaaagacggtgcgcag
aagatcgtggagttggccaaatga

DBGET integrated database retrieval system