KEGG   Truepera radiovictrix: Trad_1307Help
Entry
Trad_1307         CDS       T01254                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tra  Truepera radiovictrix
Brite
Enzymes [BR:tra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Trad_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1399911..1400723)
Genome map
AA seq 270 aa AA seqDB search
MDAARFYGHERHQDFWLGEGPRRALLVHGFPGTPAELRALGGWLAARGFRVHAPLLPGFG
ADIPNLGKTRRAAWLGAARRAWEALREGQGAQTVLLGFSMGGALALQVAARGAPPDKLVL
LAPFWRLRDPRARWLPALQYAVRELRPFENTDFSASTVRAQFARLEPSLDLDDPAVQEAL
RTQVALPTSALVELQRLGAEAYRAAPRVRAPALVIQGLDDDTVAATDTRRLALRLGGPVT
LFEVPGSHHLIAPGGPEFAGLCERLERELL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggacgctgcacgcttctacggtcacgagcggcaccaggacttctggttgggcgagggc
ccccgccgcgcccttctcgtgcacgggttcccggggacgccggcggagctgcgggcgcta
gggggctggctcgccgcgcgcggctttagggtccacgccccgctgctgccgggtttcggc
gccgatatccccaacctcggcaagacgcgccgcgcggcgtggctcggggcggcgcgccgc
gcttgggaggcgctgcgcgaggggcaaggggcgcagacggtcctattgggcttttcgatg
gggggcgccctcgcgcttcaggtcgccgccagaggcgccccccccgacaagctcgtcctc
ttggcccctttttggcggctgcgcgaccccagggcgcggtggctccccgcgctgcagtac
gcggtgcgcgagctgaggcccttcgagaacaccgactttagcgccagcaccgtgcgggcg
cagttcgcgcggctcgagcccagcttggacctcgacgaccccgccgtgcaggaggcgctc
cgcacgcaggtcgccctgccgacctccgcgctcgtcgagctgcagcgcctcggcgccgaa
gcctaccgcgccgccccccgcgtgcgggcgcccgcgctcgtcatccaggggcttgatgac
gacaccgtcgccgctaccgacacccgccgcctggcgctgcgcctcggcggccccgtgacg
ctcttcgaggtgcccggcagccatcacctcatcgcgcccggtggccccgagttcgccggg
ctctgcgagcggctcgagcgggagctgttgtag

DBGET integrated database retrieval system