KEGG   Truepera radiovictrix: Trad_1355Help
Entry
Trad_1355         CDS       T01254                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tra  Truepera radiovictrix
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trad_1355
  Amino acid metabolism
   00340 Histidine metabolism
    Trad_1355
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Trad_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1454984..1456303
Genome map
AA seq 439 aa AA seqDB search
MMGAMRVLHGLGEAAPLFAARQGPDSAAHEEAVRAILARVRAEGDAALFDLTERFDGVRL
GALQVPEAAFAAAEREVPAALQDAMRLSAARIRAFYERQPQEGFLYPAEGGLLGQLVRPV
TRVGVYAPAALFSTLLMCAVPAQVAGVREIAVATPPRGDGRVAPEILVAARLLGLTEVYA
VGGAQAIGALAYGTESVPRVDKIVGPGNAYVVLAKRLVFGEVGIEALPGPTETLVLADES
AEAHHVAADLLAQAEHAGAQPVFVTTSEALLEAVQLELTRQLVTLPTREVAAASLGRGYA
VLVGTLEEGVEVANRYAPEHLCLLVRDPWAVLPAVEHAGGVFLGASSMEALGDYAAGPSH
VMPTGATARFSSALNVRDFQKVIPLVNVSAETLGRIGPASAQMARAEGLEAHARAIEARL
KRDAPGDAPATAAGAVLRD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggccatgagagtgttgcacggtctaggggaagccgcccccctcttcgcggcg
cgccagggccctgacagcgcagcccacgaggaggccgtccgggcgattttggcgcgcgtc
cgcgcggagggcgacgccgccctgttcgacctcaccgagcgctttgacggcgtgcgtctg
ggcgcgctgcaggttcccgaggccgccttcgcagcggccgagcgggaggtccccgcagcg
ctgcaagacgccatgcgcctgagcgccgcgcgcatccgcgctttttacgaacggcagccg
caggagggctttttgtaccccgccgagggggggctcttggggcaactcgtccggcccgtc
acgcgggtcggggtgtacgcccccgctgccctctttagcaccctcctcatgtgcgccgtg
cccgcacaggtcgcgggcgtccgcgagatcgccgtggcgaccccgccgcggggtgacggc
cgcgtcgcgccggagatcctggtggccgcgcgcctcttgggcctcaccgaggtctacgcg
gtcgggggggcgcaggcgatcggcgcgctcgcctacggcaccgagagcgtcccccgcgtc
gacaagatcgtcgggccgggcaacgcctacgtcgtgctcgccaaacggctcgtcttcggc
gaagtcggtatcgaggcgctccctgggcccaccgagacgctcgtcttggccgacgaaagc
gccgaggcgcaccacgtcgccgccgacctcttggcccaggccgaacatgcgggcgcgcag
ccggttttcgtcacgaccagcgaggcgctcctagaggccgtgcagctcgagctcacgcgc
cagctcgttacgctcccgacccgcgaggtcgcagcggcctccctggggcgcggctacgcc
gtcttggtcggaacgctcgaagagggggtcgaggtcgccaaccgctacgcccccgaacac
ctctgcttgctcgtgcgcgacccgtgggcggtgctccccgccgtcgagcacgcgggcggc
gtcttcctgggcgcctcgagcatggaggcgttgggcgactacgcggcggggccgagccac
gtgatgcccacgggcgctacggcgcgcttttcaagcgcgctcaacgtccgcgactttcag
aaggtgatccccctcgtcaacgtcagcgccgagacgctggggcgcatcggccccgcttcg
gcgcaaatggcccgcgccgaggggctcgaggcccacgcccgcgccatcgaggcgcgcctt
aaacgggacgcgccaggcgacgccccggccactgcggctggagcggtgctccgtgactag

DBGET integrated database retrieval system