KEGG   Truepera radiovictrix: Trad_1411Help
Entry
Trad_1411         CDS       T01254                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
tra  Truepera radiovictrix
Pathway
tra00330  Arginine and proline metabolism
tra01100  Metabolic pathways
Module
tra_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Trad_1411
Enzymes [BR:tra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Trad_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADI14533
UniProt: D7CX25
Position
complement(1509538..1510503)
Genome map
AA seq 321 aa AA seqDB search
MPRYRPPDAMVYPRFEGIRTFMRLPHVTDLAGAGIDAAIVGAPFDTGGTYRVGARFGPAG
IRHESMLLRPYHPELRVDVTEQLSLVDYGDLPVTPGYLSESHAQLERGAAELVAAGVTPF
FLGGDHSVSLPLLRAVAQRHGPVGLVHIDAHSDLWEGYFGGKDTHGTPFRRALEEGLLEP
ARSIQIGLRGSLYSAEDHALSQRLGFEMVTAPELHRVGVQEVARRVRARAGTGPLYLSFD
IDALDPTFAPGTGTPEVGGLSSVQALALLRALAGLPFVAYDLVEVMPPYDVAGTTCLLAA
NLVYEMLALEACRRLGAAEAR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctaccgcccccccgacgccatggtctacccccgtttcgaggggatccgcacc
tttatgcggctgccgcacgtcaccgacctcgctggcgccggtatcgacgccgccatcgtc
ggcgcacccttcgacaccggcggcacctaccgcgtcggcgcgcgcttcggccccgccggc
atccgccatgagtcgatgctgctgcgcccctaccaccccgagctgcgcgtcgacgtcacc
gagcagctctcgctcgtcgactacggcgaccttcccgtcacccccgggtacttaagcgag
tcgcacgcccagctcgagcggggcgctgccgagctcgtcgcggccggggtcacgcccttc
tttctggggggcgaccactcggtgtcgctgccgctgctgcgggctgtggcccagcgtcac
ggccccgtggggctcgtccacatcgacgcgcatagcgacctctgggaggggtacttcggc
ggcaaagacacccacggcaccccctttcggcgggcgctcgaagaggggctcctcgagccc
gcccgctccatccagataggcttgcgcgggtccctttacagcgccgaggaccacgccctc
tcgcagcgcctgggctttgagatggtcaccgcccccgagctgcaccgcgtcggcgtccag
gaggtcgcccgccgcgtgcgcgcgcgcgcgggcacggggccgctctacctcagcttcgac
atcgacgccctcgacccgaccttcgcccccggcaccggcacccccgaggtcggcgggctg
agcagcgtgcaggcgctagcgctcctgcgcgccctcgcgggccttcctttcgtcgcctac
gacctcgtcgaggtcatgcccccctacgacgtcgccggtacgacctgcttgctcgccgcc
aacttggtctacgagatgctggcgctcgaggcgtgccggcgtttgggggcggccgaggcg
cggtga

DBGET integrated database retrieval system