KEGG   Truepera radiovictrix: Trad_1463Help
Entry
Trad_1463         CDS       T01254                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tra  Truepera radiovictrix
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tra00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1567493..1568446
Genome map
AA seq 317 aa AA seqDB search
MKSYPAESRYDKPVTTPPSRPASTPTGHGLTFAYPVPGGVRTAAGWRWRWSGVAVMGILN
VTPDSFSDGGRYLAPERAAAHAQALIAAGAAVLDVGAESTRPGAEPVPAEVELDRLLPVL
ARLKGAPVPLSVDTYKPEVAAAALAAGAHLVNDVSGLRDPEMVRVCAAAGAPAVVMHMQG
TPKTMQDAPHYEDVVGEVRGFLQARAAAALEAGVPSVLLDPGIGFGKTLAHNLALLRNLR
AFTALGHPVLLGASRKGIVRLLTGAEAPEARDAGSLALHLWGVQQGVSMVRVHEVAAHVS
ALKAWAALADEGAVGET
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctaccccgccgagagccggtacgataaacccgtgaccaccccaccctccaga
cccgcgtccaccccaaccggccacggcctgacgttcgcctaccccgtccccgggggcgtc
cgcaccgctgcggggtggcgctggcgctggtcgggggtcgccgtcatggggattctcaac
gtgacccccgattcgttctccgacggcggccgctacctcgcgccggagcgggccgcagcg
cacgcgcaggcgctcatcgcggcgggggcggcggtgctcgacgtcggcgccgagtcgacc
cgccccggcgccgagcccgtccccgccgaggtcgagctcgaccggctgttgccggtgctc
gcgcgccttaaaggggcgcccgtgccgctcagcgtcgacacctacaaacccgaggtcgcc
gccgcggcgctcgcggcgggcgcgcacctcgtcaacgacgtcagcggtctgcgcgacccc
gagatggtgcgcgtctgcgcggccgcgggggcgccggccgtggtgatgcacatgcagggg
acgccgaagacgatgcaggacgcaccccactacgaggacgtggtgggggaggtgcggggc
tttttgcaggcgcgcgccgccgcggcgctcgaggcgggcgtcccgagcgtgctgctcgac
cccggcatcggcttcggcaagaccctggcgcacaacctggcgctgttgcggaacctgcgg
gcgttcaccgcgctcggccaccccgtcttgctgggcgcttcgcgcaaggggatcgtgcgg
ctgctcacgggcgccgaagcgcccgaggcgcgcgacgcgggctccctggcgctgcacctc
tggggggtgcagcagggggtcagcatggtgcgggtgcatgaggtggccgcccacgtcagc
gcgcttaaagcgtgggcggcgctcgcggacgagggcgctgtgggggagacctga

DBGET integrated database retrieval system