KEGG   Truepera radiovictrix: Trad_1465Help
Entry
Trad_1465         CDS       T01254                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tra  Truepera radiovictrix
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Trad_1465
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Trad_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1568788..1569321
Genome map
AA seq 177 aa AA seqDB search
MSVREGDSASGGVEGVFVALGANLGDPLASLRWARTALSSVSRIRGASSLYRTAPVGGPP
GQPDYLNAVLELTPFEEEPERFMAVLLELERRCGRVRSERWGPRTLDLDLLAWGARVQKS
PRLTLPHPRMMVRAFVLAPLCELAPSWRHPVTGTLACDALRALGGAPPVVRTPLAWG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttcgtgagggcgatagcgccagcggcggcgtcgaaggtgtcttcgtcgcgcta
ggggcgaacctgggcgacccgctcgcgagcttgcgctgggcccggaccgcgctctctagc
gtgagccgcatccggggcgcctcgagcctctaccgcaccgcgccggtcggcggcccgccg
gggcaacccgactacctcaacgcggtcttagagctcacgcccttcgaggaggagccggag
cgcttcatggcggtgctcttagagctcgagcgccgctgcgggcgcgtccgcagcgagcgc
tgggggccgcgcaccttggacctcgacctcttggcgtggggcgcgcgcgtccaaaagagc
ccgaggctcaccctgccgcacccccgcatgatggtgcgcgctttcgtgctggcgcccctt
tgcgagctggcgccgagctggcggcatccggtgacgggtaccctggcgtgtgacgcgctg
cgagcgctcgggggcgcgccgccggtcgtccggacccctctggcgtggggttga

DBGET integrated database retrieval system