KEGG   Truepera radiovictrix: Trad_1503Help
Entry
Trad_1503         CDS       T01254                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
tra  Truepera radiovictrix
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Trad_1503
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Trad_1503
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Trad_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606629..1607552
Genome map
AA seq 307 aa AA seqDB search
MTHRPTLSAIDYGKGDIGVYRFAAPTYRVPAIPESPFTGRAHDLFAAEVGVQVLGGPFAA
AYTEGDNRNVVATDTMKNFVLKHALAFEGATLEAFLDSLGRAFFEAYPDMETLRLTGREV
PFAAAPVRQGETFVPSPVLLSRSRGDCGAAALLVTREGVRELESGRLGLQLLKTTGSSFA
SFARDAHTTLPEMHDRPLLIYLDAFWRYRDPAAALQTGTGELTGYVASEQVRDLLAATFH
DVNSRSIQHLVYEMGVRLLARFPQLREVRFEAQNRLWDHAFSDDETGRKVHTDPRPPYGR
IGLTLTA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaccgccccaccctcagcgccatcgactacggcaagggggacatcggcgtctac
cgcttcgccgcccccacctaccgcgtccccgcgatccccgagtcgccctttacgggccgc
gcgcacgaccttttcgccgccgaggtgggcgtgcaggtcctgggcggccccttcgcggcg
gcctacaccgagggcgacaaccgcaacgtcgtcgccaccgacacgatgaagaactttgtc
ctcaagcacgcgctcgcgttcgagggggcgaccctggaggcgtttttggactcgctcggg
cgcgcctttttcgaggcctatccggacatggagaccttacggctcaccggccgcgaggtg
cccttcgccgcggcgcccgtccggcaaggggagaccttcgtcccgagcccggtgctcctg
tcgcgctcgcggggcgactgcggtgcggcggcgctcctcgtgacgcgcgaaggggtgcgc
gagctcgagagtggccggctcgggttgcagctcctgaagaccaccggctcctcgtttgcg
agctttgcccgcgacgcccacaccaccctccccgagatgcacgaccgccccctactgatc
tacctcgacgccttttggcgctaccgcgaccccgcggcggcgctccaaacggggacgggg
gagctaacgggctacgtggcttccgagcaggtgcgcgaccttttggcggcgacctttcac
gacgttaacagccgctcgatccagcacctcgtctacgagatgggggtgcggctgctggca
cgctttccgcagctccgtgaggtccgcttcgaggcgcaaaaccggctttgggaccacgct
tttagcgacgacgaaacgggccgcaaggttcacaccgacccgcgcccgccgtacggccgc
atcggtctcacgctcaccgcctag

DBGET integrated database retrieval system