KEGG   Truepera radiovictrix: Trad_1533Help
Entry
Trad_1533         CDS       T01254                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02010  iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
tra  Truepera radiovictrix
Pathway
tra02010  ABC transporters
Module
tra_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:tra00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Trad_1533
Enzymes [BR:tra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.30  Fe3+-transporting ATPase
     Trad_1533
Transporters [BR:tra02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    Trad_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 TOBE_2 AAA_25 AAA_16 AAA_28 AAA_33 RsgA_GTPase AAA SMC_N AAA_22 Rad17 NACHT AAA_18 SbcCD_C AAA_29 AAA_5 AAA_23 PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ADI14652
UniProt: D7CXQ0
Position
complement(1638772..1639812)
Genome map
AA seq 346 aa AA seqDB search
MEAPVLAVRHLSKRYSASQPPALHRVDLEVARGELVALLGPSGCGKTTLLRLLAGFEVPD
EGEVAVAGTVVATPERQLPPEARRLGVVFQDYALFPHLSVLHNVAFGLRALPRRQRRARV
EEVLALVGLQDFGHRYPHQLSGGQQQRVALARALAPEPEVLLLDEPFSNLDAALREETRG
EVRRILKASGASALLVTHDQEEAMTFAERLAIMRQGRLEQMGAPEAVYRAPRNAFVASFL
GATNLLQGIAEGSVAHTPVGPLELSRPAQGPVLLSLRPECLQFCARGAPVRVLSRAFKGH
DLTYTCQLVGAQEPCVLTVHTGPVCPLREGDVGYVATAAEAVVLEA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgcccgtgctcgccgtccgccacctctccaagcgttacagcgcctcccaaccg
cccgctctgcaccgcgtcgacctcgaggtcgcgcggggggaactcgtcgcgctcctggga
ccctcggggtgcggtaagacgaccctgctgcggctgctcgcgggtttcgaggtgcccgac
gagggggaggtcgcggtcgctggaacggtcgtggcgacgcccgagcgccagctccccccc
gaagcgcggcgcctcggggtggtgtttcaggactacgccctgtttccccacctcagcgtg
ttgcacaacgtggctttcggtctccgcgcactcccgcggcggcagcgccgggcgcgcgtg
gaggaggtgctggcgctcgtcggcctgcaggacttcggccaccgctacccacaccagctc
tccggcgggcagcagcagcgcgtggccctagcgcgcgcgctcgccccggagcccgaggtg
ctcctgttagacgagccctttagcaacctcgacgccgcgctgcgcgaggagacccggggc
gaggtgcgccgcatcctcaaagcgagcggcgctagcgcgctgctggtgacccacgaccag
gaggaggcgatgacgtttgccgagcgcctagcgatcatgcgccaggggcgcttggagcag
atgggcgcgcccgaagcggtctaccgcgccccgcgcaacgccttcgtggcgagctttctg
ggggcgacgaacctgctgcaggggatcgccgagggcagcgtggcgcacacgccggtcggg
ccgctcgagctttcgcgcccggcccaagggcccgtactgctctcgttgcgccccgaatgc
ctccagttttgtgcccgcggcgcccccgtgcgggtcttgagccgcgcctttaagggccac
gacctcacctacacgtgccaactcgtcggcgcccaagagccgtgcgtgctgaccgtccac
acgggcccggtgtgccccttacgcgaaggggacgtcggttacgttgcaaccgcggcggag
gcggtggtgctcgaagcgtag

DBGET integrated database retrieval system