KEGG   Truepera radiovictrix: Trad_1533Help
Entry
Trad_1533         CDS       T01254                                 

Definition
ABC transporter-like protein
Orthology
K02010  
iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
tra  Truepera radiovictrix
Pathway
ABC transporters
Module
Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:tra00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Trad_1533
Enzymes [BR:tra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.30  Fe3+-transporting ATPase
     Trad_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1638772..1639812)
Genome map
AA seq 346 aa AA seqDB search
MEAPVLAVRHLSKRYSASQPPALHRVDLEVARGELVALLGPSGCGKTTLLRLLAGFEVPD
EGEVAVAGTVVATPERQLPPEARRLGVVFQDYALFPHLSVLHNVAFGLRALPRRQRRARV
EEVLALVGLQDFGHRYPHQLSGGQQQRVALARALAPEPEVLLLDEPFSNLDAALREETRG
EVRRILKASGASALLVTHDQEEAMTFAERLAIMRQGRLEQMGAPEAVYRAPRNAFVASFL
GATNLLQGIAEGSVAHTPVGPLELSRPAQGPVLLSLRPECLQFCARGAPVRVLSRAFKGH
DLTYTCQLVGAQEPCVLTVHTGPVCPLREGDVGYVATAAEAVVLEA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgcccgtgctcgccgtccgccacctctccaagcgttacagcgcctcccaaccg
cccgctctgcaccgcgtcgacctcgaggtcgcgcggggggaactcgtcgcgctcctggga
ccctcggggtgcggtaagacgaccctgctgcggctgctcgcgggtttcgaggtgcccgac
gagggggaggtcgcggtcgctggaacggtcgtggcgacgcccgagcgccagctccccccc
gaagcgcggcgcctcggggtggtgtttcaggactacgccctgtttccccacctcagcgtg
ttgcacaacgtggctttcggtctccgcgcactcccgcggcggcagcgccgggcgcgcgtg
gaggaggtgctggcgctcgtcggcctgcaggacttcggccaccgctacccacaccagctc
tccggcgggcagcagcagcgcgtggccctagcgcgcgcgctcgccccggagcccgaggtg
ctcctgttagacgagccctttagcaacctcgacgccgcgctgcgcgaggagacccggggc
gaggtgcgccgcatcctcaaagcgagcggcgctagcgcgctgctggtgacccacgaccag
gaggaggcgatgacgtttgccgagcgcctagcgatcatgcgccaggggcgcttggagcag
atgggcgcgcccgaagcggtctaccgcgccccgcgcaacgccttcgtggcgagctttctg
ggggcgacgaacctgctgcaggggatcgccgagggcagcgtggcgcacacgccggtcggg
ccgctcgagctttcgcgcccggcccaagggcccgtactgctctcgttgcgccccgaatgc
ctccagttttgtgcccgcggcgcccccgtgcgggtcttgagccgcgcctttaagggccac
gacctcacctacacgtgccaactcgtcggcgcccaagagccgtgcgtgctgaccgtccac
acgggcccggtgtgccccttacgcgaaggggacgtcggttacgttgcaaccgcggcggag
gcggtggtgctcgaagcgtag

DBGET integrated database retrieval system