KEGG   Truepera radiovictrix: Trad_1540Help
Entry
Trad_1540         CDS       T01254                                 

Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
tra  Truepera radiovictrix
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trad_1540
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Trad_1540
   00630 Glyoxylate and dicarboxylate metabolism
    Trad_1540
Enzymes [BR:tra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Trad_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1646230..1647783
Genome map
AA seq 517 aa AA seqDB search
MTVEVQAKTPEAAQTVLSPGALEFLRALQREFGTRRRELLARRAARQRAFDAGEDPDFLP
ETRAVREGDWRVAEAPADLMDRRVEITGPAEPKMIINALNSGAKVFMADFEDALSPTWHN
VLAGQRALAAAVRRTLVHEAQGKTYRLGEALATLVVRPRGWHLEERHVHVDGAPISASLF
DFGLFLFGNAHELLERGSGPYFYLPKLESHLEARLWNDVFNFAQDYLRIPRGTIRATVLI
ETLPAAFEMDEILFELKDHAAGLNAGRWDYIFSFIKTFRARPDKLLPDRAQVTMTVPFMH
AYTELLIKTCHKRGAHAMGGMAAFIPNRKDPEVTERALEKVREDKRREARAGCDGTWVAH
PDLIPVAMAEFDAVLGDAPHQKARGREEVAVRAEDLVNADVPGGAVTEAGVRNNINVALQ
YLSAWLSGTGAAAIHNLMEDAATAEISRAQLWQWRTHGATLEGGERVSEALYRRLKDEEL
ASLQGAHLETAAELLDHLVLNPEFETFLTLRAYAHLD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgacggttgaggtacaggccaaaacgccagaggcggcgcagacggtcttgagcccaggg
gcgctcgagtttttaagggcgctccagcgcgagtttggcacccggcgccgcgagctcttg
gcgcggcgcgcggcgcggcagcgggcctttgacgcgggggaagaccccgactttctcccc
gagacgcgcgcggtgcgagagggcgactggcgcgtcgcggaggcgcccgctgacctgatg
gaccgccgcgtcgagatcaccggccccgccgaacccaagatgatcatcaacgcgctcaac
tcgggcgcaaaggtcttcatggccgacttcgaggacgcgctgtcgccgacgtggcacaac
gtcttagcggggcagcgggcgctcgccgcggcggtgcggcggacgctcgtgcacgaagcg
cagggcaagacctaccggctcggggaggctttggcgacgctcgtggtgcgcccccgcggg
tggcacctcgaggagcggcacgtgcacgtagacggcgcgccgatctcggcgagcctcttc
gacttcgggctcttcttgttcggcaacgcccacgagctcctcgagcgcggttcgggccct
tacttctacctgcccaagctcgagagccacctcgaggcgcggctctggaacgacgtcttc
aacttcgcccaggactacctaagaatcccgcgcgggacgattcgggcgaccgtcctgatc
gagacgctccccgccgccttcgagatggacgagatcctcttcgaactcaaagaccacgcc
gcggggcttaacgccgggcgctgggactacatcttctcgtttatcaagaccttccgcgcg
cgccccgacaagctcttgcccgaccgcgcgcaggtcaccatgacggtgccctttatgcac
gcctacacggagctgctcattaaaacgtgccacaagcgcggggcgcacgccatgggcgga
atggcggcctttatccccaaccgcaaggaccccgaggtcaccgagcgggcgctcgaaaag
gtgcgcgaggacaaacgccgcgaggctagggcggggtgcgacggcacctgggtcgcccac
cccgacctcatcccggtcgccatggccgagttcgacgcggtgcttggggacgccccccac
cagaaggcgcgcggacgcgaggaggtcgcggtgcgcgccgaggacctcgtcaacgccgac
gtgcccgggggggcggtgaccgaggcgggggtcaggaacaacatcaacgtggcgctgcag
tacctcagcgcgtggctctcgggtacgggcgccgccgccatccacaacctcatggaggac
gccgcgacggccgagatctcgcgcgcgcagctctggcagtggcgcacgcacggggcgacg
ctcgagggaggcgagcgggtctccgaggcgctctaccggcgcctcaaagatgaggagctg
gccagccttcaaggggcgcacctcgaaacggcggccgagctgctcgatcacctcgtgcta
aaccccgagttcgaaacctttttgaccctgcgcgcttacgcgcacctcgactag

DBGET integrated database retrieval system