KEGG   Truepera radiovictrix: Trad_1541Help
Entry
Trad_1541         CDS       T01254                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tra  Truepera radiovictrix
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tra01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tra00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1647847..1649133
Genome map
AA seq 428 aa AA seqDB search
MSQPQTTQDAQTLASLWSTDPRWSGIERPYSAEEVLALRPSVKVEYTLARRGAEKLWDLL
HTEPYVNTFGALTGAQAVQMVKAGLKAIYLSGWQVAADANLAAHTYPDQSLYPANSVPAV
VRRLNNALMRADQIDKLEGNTATDYYAPIVADAEAGFGGPLNAFELMRAMIEAGAAGVHF
EDQLASEKKCGHLGGKVLVPTGTFIRTLAAARLAADVMDVPTVLIARTDAHAATLLTSDV
DERDHPFLTGERTPEGYFYVRPGLEASVARALAYAPYADLIWMETSTPDLEEARRFAEAV
HEHFPGKGLAYNCSPSFNWRRHLDDATIAAFQRELGAMGYRFQFITLAGWHTLNLRTFEL
ARGYAESGMSAYVALQEEEFARERDGYTATRHQREVGTGYFDRVLQTATAGQASTAALVG
STEAEQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagccccaaacgacccaagacgcccaaaccctagcgagcctctggtccaccgac
ccgcgctggagcgggatcgagcggccctacagcgccgaggaggtgctcgccctgcgcccc
tcggtcaaggtcgagtacaccctcgcgcgccgcggcgccgaaaagctctgggacctgctg
cacaccgagccctacgtgaacaccttcggcgcgctcaccggcgcccaggccgtgcagatg
gtcaaagcgggccttaaagccatctacctctcggggtggcaggtcgccgccgacgccaac
ctcgccgcccacacctaccccgaccagagcctctaccccgccaacagcgtcccggccgtg
gtgcggcgcctcaacaacgccctcatgcgcgccgatcagatcgacaagctagagggcaac
accgcgaccgactactacgcgcccatcgtcgccgacgccgaggcgggttttggcggcccc
ctcaacgcctttgagctgatgcgcgcgatgatcgaagcgggtgccgccggggtgcacttc
gaggaccagctcgcgagcgagaaaaagtgcggccacctaggcggcaaggtgctcgtaccg
accggcacctttatccgcacgctggccgccgcgcgcctcgccgcggacgtcatggacgtg
ccgacggtgctgattgcccgcaccgacgcgcacgccgccacgctcctgacttctgacgtc
gacgagcgcgaccaccccttcctcaccggcgaacgcacccccgaggggtacttctacgtc
cggccggggctcgaggcctccgtcgcgcgggcgctcgcctacgccccgtacgccgacctc
atctggatggagacctcgacgcccgacctggaagaagcgcggcggttcgccgaggcggtc
cacgagcacttccctggcaaggggttggcctacaactgctcgccctcgtttaactggcgg
cgccacctcgacgacgccaccatcgccgcgttccagcgcgagctgggcgccatggggtac
cgcttccagttcatcaccctggcggggtggcacaccctcaacctgcgcaccttcgagctc
gcgcgtggctacgccgaatccggtatgagcgcctacgtcgcgctccaagaggaggagttc
gcccgcgaacgcgacggctacaccgcgacgcgccaccagcgcgaggtcggcacgggttac
ttcgaccgcgtgctgcagaccgccaccgccgggcaagcgtcgaccgccgcgctggtcggc
tcgaccgaagcggagcagtttcactag

DBGET integrated database retrieval system