KEGG   Truepera radiovictrix: Trad_1541Help
Entry
Trad_1541         CDS       T01254                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
tra  Truepera radiovictrix
Pathway
tra00630  Glyoxylate and dicarboxylate metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01200  Carbon metabolism
Module
tra_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Trad_1541
Enzymes [BR:tra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Trad_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADI14660
UniProt: D7CXQ8
Position
1647847..1649133
Genome map
AA seq 428 aa AA seqDB search
MSQPQTTQDAQTLASLWSTDPRWSGIERPYSAEEVLALRPSVKVEYTLARRGAEKLWDLL
HTEPYVNTFGALTGAQAVQMVKAGLKAIYLSGWQVAADANLAAHTYPDQSLYPANSVPAV
VRRLNNALMRADQIDKLEGNTATDYYAPIVADAEAGFGGPLNAFELMRAMIEAGAAGVHF
EDQLASEKKCGHLGGKVLVPTGTFIRTLAAARLAADVMDVPTVLIARTDAHAATLLTSDV
DERDHPFLTGERTPEGYFYVRPGLEASVARALAYAPYADLIWMETSTPDLEEARRFAEAV
HEHFPGKGLAYNCSPSFNWRRHLDDATIAAFQRELGAMGYRFQFITLAGWHTLNLRTFEL
ARGYAESGMSAYVALQEEEFARERDGYTATRHQREVGTGYFDRVLQTATAGQASTAALVG
STEAEQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagccccaaacgacccaagacgcccaaaccctagcgagcctctggtccaccgac
ccgcgctggagcgggatcgagcggccctacagcgccgaggaggtgctcgccctgcgcccc
tcggtcaaggtcgagtacaccctcgcgcgccgcggcgccgaaaagctctgggacctgctg
cacaccgagccctacgtgaacaccttcggcgcgctcaccggcgcccaggccgtgcagatg
gtcaaagcgggccttaaagccatctacctctcggggtggcaggtcgccgccgacgccaac
ctcgccgcccacacctaccccgaccagagcctctaccccgccaacagcgtcccggccgtg
gtgcggcgcctcaacaacgccctcatgcgcgccgatcagatcgacaagctagagggcaac
accgcgaccgactactacgcgcccatcgtcgccgacgccgaggcgggttttggcggcccc
ctcaacgcctttgagctgatgcgcgcgatgatcgaagcgggtgccgccggggtgcacttc
gaggaccagctcgcgagcgagaaaaagtgcggccacctaggcggcaaggtgctcgtaccg
accggcacctttatccgcacgctggccgccgcgcgcctcgccgcggacgtcatggacgtg
ccgacggtgctgattgcccgcaccgacgcgcacgccgccacgctcctgacttctgacgtc
gacgagcgcgaccaccccttcctcaccggcgaacgcacccccgaggggtacttctacgtc
cggccggggctcgaggcctccgtcgcgcgggcgctcgcctacgccccgtacgccgacctc
atctggatggagacctcgacgcccgacctggaagaagcgcggcggttcgccgaggcggtc
cacgagcacttccctggcaaggggttggcctacaactgctcgccctcgtttaactggcgg
cgccacctcgacgacgccaccatcgccgcgttccagcgcgagctgggcgccatggggtac
cgcttccagttcatcaccctggcggggtggcacaccctcaacctgcgcaccttcgagctc
gcgcgtggctacgccgaatccggtatgagcgcctacgtcgcgctccaagaggaggagttc
gcccgcgaacgcgacggctacaccgcgacgcgccaccagcgcgaggtcggcacgggttac
ttcgaccgcgtgctgcagaccgccaccgccgggcaagcgtcgaccgccgcgctggtcggc
tcgaccgaagcggagcagtttcactag

DBGET integrated database retrieval system