KEGG   Truepera radiovictrix: Trad_1728Help
Entry
Trad_1728         CDS       T01254                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tra  Truepera radiovictrix
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Trad_1728
Enzymes [BR:tra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Trad_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1861902..1863929
Genome map
AA seq 675 aa AA seqDB search
MTIFYGGDYNPEQWPEATWHEDVTLMQEAGVNLVSVAIFAWSKLEPEPGRFDFGWLDRLL
DLLHEHGIGVCLATATAAPPPWLAHQHPESLPVTATGVRLGVGSRQQYSPSSPAYKEAAA
RLVRAIAERYKGHPALKLWHVNNEYGCHVYESFDEDSAAAFRAWLRARYGTLEALNAAWG
TAFWSQLYHHWEEITPPRAAPTFLNPTQQLDWRRFCSDALLALYKMERDILREVTPEVPI
TTNFIGVHKPIDAWRWAEALDLVANDAYPDPSDPEAPIHAAFASDVMRSLKGGAPWLLME
QAPNQVQWRPRNALKAPGVMRLWSLQALARGARGVMFFQWRQSKAGAEKFHSGMVPHGGT
ETRTWHEVKALGQELKGLGELLESTLRSDVAVVLDWDTWWALELDAKPSDGVRYLETLYA
PYAELWRRNIGVTFVRPDADLSPYKLVVAPNLYLVTDEAAANLESYVRGGGVLVMGFFSG
IVDEHDQVRLGGYPAPFRQLLGLRVEEFDALPAGARLSVRLPAGDVSAETWADVIHLEGA
EALGTFGAGFYAGGPAVTRHRFGRGVSFYIGTRLAAEGLAWVLAEACREAGVAPVLETPP
GVEAVARTRGGARYLALFNHSDETVTVALPERFTALGSGALQEGTLELAARDAVFLRARS
ATHAQEPAERERSPV
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttttacggcggcgactacaaccccgagcagtggcccgaagcgacctggcac
gaggacgtgacgctgatgcaggaggcgggggtgaacctcgtgagcgtcgccatcttcgcc
tggtcgaagctcgagcccgaaccgggccgcttcgacttcgggtggctcgaccggcttcta
gacctcctgcacgagcacggcatcggcgtctgcctcgcgaccgcgaccgccgcccccccg
ccgtggctcgcgcaccaacaccccgagagtctccccgtgaccgccacgggggtgcgcttg
ggggtcggctcgaggcagcagtatagcccgtctagccccgcgtacaaggaggccgccgcg
cggctcgtgcgcgcgatcgcggagcgctacaagggtcaccccgccctcaagctctggcac
gtgaataacgagtacggctgccacgtctacgagtcgttcgacgaggactcggcggcggcc
tttcgggcgtggttaagagcgcgctacggcaccctggaggcgctcaacgccgcctggggc
accgctttctggagccagctctatcaccattgggaggagatcaccccgccgcgcgccgcg
ccgacctttctcaacccgacccagcagctcgactggcggcgcttttgcagcgacgcgctg
ttggcgctctacaagatggagcgcgacatcctccgcgaggtgacgccggaggtgcccatc
accacgaactttatcggggtgcataaacccatcgacgcctggcgctgggccgaagcgctc
gacctcgtcgccaacgacgcctaccccgacccgagcgaccccgaagcgcccatccacgcc
gctttcgcgagcgacgtgatgcgctcgcttaaggggggcgccccctggctcctcatggag
caagcccccaaccaggtgcagtggcggccgcgcaacgcccttaaagcccccggtgtgatg
cgcctctggagccttcaggcgctcgcgcgcggcgcgcgcggcgtgatgttctttcagtgg
cggcagtcaaaagccggggcggaaaagttccatagcggcatggtcccccacggcggcacc
gagacgcgcacctggcacgaggtcaaagcgctcggccaggagctcaagggcctcggcgag
ctgctcgagagcacccttcgcagcgacgtcgccgtggtgctcgactgggacacctggtgg
gctttagagctcgacgccaaaccctcggacggggtgcgctacttagagacgctctacgcc
ccttacgccgagctgtggcggcgcaacatcggcgtcaccttcgtccgcccggacgccgac
ctgagcccctacaagctggtcgtcgcacccaacctctacctcgttaccgacgaggcggca
gccaacttggagagctacgtccgcgggggcggggtgctcgtcatgggcttttttagcggc
atcgtcgacgaacacgaccaggtgcggctggggggctacccggcgccctttcgccagctc
ctggggttgcgcgtcgaggagtttgacgcgctgcccgcgggcgcgcgcctcagcgtgcgg
ctgcccgcgggcgacgtgagcgccgagacctgggccgacgtcatccacctcgagggcgcc
gaggcgctcggcaccttcggggcggggttctatgcggggggccctgccgtgacccgccac
cgcttcgggcgcggggtgagcttttatatcggcacgcgcttggcggccgaagggctcgcc
tgggtgctcgcagaggcgtgccgcgaggccggcgtcgcgcccgtcctcgagacgcccccc
ggcgtcgaggcggtcgcgcgcacccgagggggggcgcgttacctcgcgctcttcaaccat
agcgacgaaacggtcacggtggcgctgccggagcgctttaccgccctcggcagcggcgcg
ttgcaagaagggacgctcgagctcgctgcgcgcgacgccgtctttttgcgggcgcgcagc
gctacgcacgcgcaggagcccgccgagcgcgaaaggagcccggtatga

DBGET integrated database retrieval system