KEGG   Truepera radiovictrix: Trad_1963Help
Entry
Trad_1963         CDS       T01254                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tra  Truepera radiovictrix
Pathway
tra00010  Glycolysis / Gluconeogenesis
tra00030  Pentose phosphate pathway
tra00051  Fructose and mannose metabolism
tra00052  Galactose metabolism
tra00680  Methane metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
tra01230  Biosynthesis of amino acids
tra03018  RNA degradation
Module
tra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_1963
   00030 Pentose phosphate pathway
    Trad_1963
   00051 Fructose and mannose metabolism
    Trad_1963
   00052 Galactose metabolism
    Trad_1963
  Energy metabolism
   00680 Methane metabolism
    Trad_1963
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Trad_1963
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Trad_1963
Protein phosphatases and associated proteins [BR:tra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Trad_1963
Messenger RNA biogenesis [BR:tra03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Trad_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1 PucR
Motif
Other DBs
NCBI-ProteinID: ADI15077
UniProt: D7CQU3
Position
2111869..2112837
Genome map
AA seq 322 aa AA seqDB search
MRHLAVLTSGGDAPGMNAAIRAVVRTAIYRGRTVSGVYRGYQGLINGDIHELGARSVANI
IQRGGTMLRSARSMPFMTPEGRAQAAENLRRHGVEGLIVIGGDGSFRGAHALSQEHGVPV
IGIPGTIDNDIYGTDVTIGFNTALNIATEAIDRLRDTAASHDRLFLVEVMGRHAGHIALN
VGLAGGAEAILLPEVPHDLDEVVSSIVEAQARGKSSSIIVVAEGAYEGGAMHLKEKIEAA
CGYEVRTSILGHMQRGGSPTTRDRVLASRLGYAAVEALLEGQQGVMAGVDKRGTVFVPLE
DTWSKQKEIDWQLFEIAKVLAV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagacaccttgccgttttgacgagtggaggcgacgcgcccgggatgaacgccgcgatc
cgcgcggtcgtgcgcacggcgatctaccgggggcgtacggtttcgggggtttacaggggc
tatcaggggctcattaatggcgacatccacgagctcggcgcccgcagcgtcgccaatatc
atccagcgcggcggcacgatgctccgcagcgcccgcagcatgccctttatgacccccgag
ggccgcgcgcaagcggctgagaacctgcgccgacacggcgtcgaggggctcatcgtcatc
ggtggcgacggctcgtttcggggggcgcacgcgctctcgcaggagcacggcgtgccggtg
atcggcatccccggtaccatcgacaacgacatctacggcacagacgtcaccatcggcttt
aacacggcgctcaacatcgccaccgaggccatcgaccggctgcgcgacacggcggcgagc
cacgaccgcctctttctggtcgaggtgatggggcgccacgccggccacatcgcccttaac
gtggggctcgccggcggggccgaggccatcttgctccccgaggtgccgcacgacctcgac
gaggtggtctcatcgatcgtcgaggcccaagcgcgcggcaagtcgtcgtcgatcatcgtc
gtcgccgagggcgcctacgaggggggcgcgatgcacctcaaagagaagatcgaggcggcc
tgcggttacgaggtgcgcacgagcatcttggggcacatgcagcggggcggttcaccgacg
acgcgcgaccgggtgctcgccagcaggctcggctacgccgctgtcgaggcgctgttggag
ggtcagcagggtgtcatggccggggtcgacaaacgcgggacggtcttcgtccccctcgag
gacacctggagcaagcaaaaggagatcgactggcagctcttcgagatcgctaaggtgctc
gccgtctaa

DBGET integrated database retrieval system