KEGG   Truepera radiovictrix: Trad_1963Help
Entry
Trad_1963         CDS       T01254                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tra  Truepera radiovictrix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tra01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tra01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tra00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tra00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tra00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tra00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tra00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2111869..2112837
Genome map
AA seq 322 aa AA seqDB search
MRHLAVLTSGGDAPGMNAAIRAVVRTAIYRGRTVSGVYRGYQGLINGDIHELGARSVANI
IQRGGTMLRSARSMPFMTPEGRAQAAENLRRHGVEGLIVIGGDGSFRGAHALSQEHGVPV
IGIPGTIDNDIYGTDVTIGFNTALNIATEAIDRLRDTAASHDRLFLVEVMGRHAGHIALN
VGLAGGAEAILLPEVPHDLDEVVSSIVEAQARGKSSSIIVVAEGAYEGGAMHLKEKIEAA
CGYEVRTSILGHMQRGGSPTTRDRVLASRLGYAAVEALLEGQQGVMAGVDKRGTVFVPLE
DTWSKQKEIDWQLFEIAKVLAV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagacaccttgccgttttgacgagtggaggcgacgcgcccgggatgaacgccgcgatc
cgcgcggtcgtgcgcacggcgatctaccgggggcgtacggtttcgggggtttacaggggc
tatcaggggctcattaatggcgacatccacgagctcggcgcccgcagcgtcgccaatatc
atccagcgcggcggcacgatgctccgcagcgcccgcagcatgccctttatgacccccgag
ggccgcgcgcaagcggctgagaacctgcgccgacacggcgtcgaggggctcatcgtcatc
ggtggcgacggctcgtttcggggggcgcacgcgctctcgcaggagcacggcgtgccggtg
atcggcatccccggtaccatcgacaacgacatctacggcacagacgtcaccatcggcttt
aacacggcgctcaacatcgccaccgaggccatcgaccggctgcgcgacacggcggcgagc
cacgaccgcctctttctggtcgaggtgatggggcgccacgccggccacatcgcccttaac
gtggggctcgccggcggggccgaggccatcttgctccccgaggtgccgcacgacctcgac
gaggtggtctcatcgatcgtcgaggcccaagcgcgcggcaagtcgtcgtcgatcatcgtc
gtcgccgagggcgcctacgaggggggcgcgatgcacctcaaagagaagatcgaggcggcc
tgcggttacgaggtgcgcacgagcatcttggggcacatgcagcggggcggttcaccgacg
acgcgcgaccgggtgctcgccagcaggctcggctacgccgctgtcgaggcgctgttggag
ggtcagcagggtgtcatggccggggtcgacaaacgcgggacggtcttcgtccccctcgag
gacacctggagcaagcaaaaggagatcgactggcagctcttcgagatcgctaaggtgctc
gccgtctaa

DBGET integrated database retrieval system