KEGG   Truepera radiovictrix: Trad_1963Help
Entry
Trad_1963         CDS       T01254                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tra  Truepera radiovictrix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trad_1963
   01230 Biosynthesis of amino acids
    Trad_1963
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_1963
   00030 Pentose phosphate pathway
    Trad_1963
   00051 Fructose and mannose metabolism
    Trad_1963
   00052 Galactose metabolism
    Trad_1963
  Energy metabolism
   00680 Methane metabolism
    Trad_1963
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Trad_1963
Protein phosphatases and associated proteins [BR:tra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Trad_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2111869..2112837
Genome map
AA seq 322 aa AA seqDB search
MRHLAVLTSGGDAPGMNAAIRAVVRTAIYRGRTVSGVYRGYQGLINGDIHELGARSVANI
IQRGGTMLRSARSMPFMTPEGRAQAAENLRRHGVEGLIVIGGDGSFRGAHALSQEHGVPV
IGIPGTIDNDIYGTDVTIGFNTALNIATEAIDRLRDTAASHDRLFLVEVMGRHAGHIALN
VGLAGGAEAILLPEVPHDLDEVVSSIVEAQARGKSSSIIVVAEGAYEGGAMHLKEKIEAA
CGYEVRTSILGHMQRGGSPTTRDRVLASRLGYAAVEALLEGQQGVMAGVDKRGTVFVPLE
DTWSKQKEIDWQLFEIAKVLAV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagacaccttgccgttttgacgagtggaggcgacgcgcccgggatgaacgccgcgatc
cgcgcggtcgtgcgcacggcgatctaccgggggcgtacggtttcgggggtttacaggggc
tatcaggggctcattaatggcgacatccacgagctcggcgcccgcagcgtcgccaatatc
atccagcgcggcggcacgatgctccgcagcgcccgcagcatgccctttatgacccccgag
ggccgcgcgcaagcggctgagaacctgcgccgacacggcgtcgaggggctcatcgtcatc
ggtggcgacggctcgtttcggggggcgcacgcgctctcgcaggagcacggcgtgccggtg
atcggcatccccggtaccatcgacaacgacatctacggcacagacgtcaccatcggcttt
aacacggcgctcaacatcgccaccgaggccatcgaccggctgcgcgacacggcggcgagc
cacgaccgcctctttctggtcgaggtgatggggcgccacgccggccacatcgcccttaac
gtggggctcgccggcggggccgaggccatcttgctccccgaggtgccgcacgacctcgac
gaggtggtctcatcgatcgtcgaggcccaagcgcgcggcaagtcgtcgtcgatcatcgtc
gtcgccgagggcgcctacgaggggggcgcgatgcacctcaaagagaagatcgaggcggcc
tgcggttacgaggtgcgcacgagcatcttggggcacatgcagcggggcggttcaccgacg
acgcgcgaccgggtgctcgccagcaggctcggctacgccgctgtcgaggcgctgttggag
ggtcagcagggtgtcatggccggggtcgacaaacgcgggacggtcttcgtccccctcgag
gacacctggagcaagcaaaaggagatcgactggcagctcttcgagatcgctaaggtgctc
gccgtctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system