KEGG   Truepera radiovictrix: Trad_1979Help
Entry
Trad_1979         CDS       T01254                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tra  Truepera radiovictrix
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Trad_1979
  Lipid metabolism
   00561 Glycerolipid metabolism
    Trad_1979
   00600 Sphingolipid metabolism
    Trad_1979
Enzymes [BR:tra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Trad_1979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129840..2131255
Genome map
AA seq 471 aa AA seqDB search
MTKITFIGAGSTVFAKNLLGDILSFPELAGAEIALFDIDAQRLKTSEVVAHKVADALGAK
PRILATTDRERALDGADYALNMIQVGGYKPATLIDFEIPKKYGLQQTIGDTLGIGGIMRA
LRTVPVLLAMARDMERLCPEVLHLNYVNPMAINCWALSRASSVRTVGLCHSVPHTAGELA
RDLGVPVGEITYRVAGINHVAFYLTFERRGEDLYPALRRIVDEGRVPETNRVRYEMLRRL
GYFVTESSEHFSEYVPWFIKRSHPELVEAFNIPIDEYLRRCEFQIASWERMRALLEDPAT
RFRVEDTASEHTDHTPTDGSVRDEARLTEQLLTIKRSPEYGSLIIHSCETGEPRVVYGNV
MNRGLIDNLPECCVEVPCLVDGNGVQPTKVGALPPQLAALMQTNVNVQALTVEAILTGRK
EHLYHAAMFDPHTAAELSLEEIHDLVDDLLAAHGDWVPEAFRPPHRRELAL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaatcacctttatcggtgccggcagcaccgtgttcgccaaaaacctcctcggc
gacatcctgagctttcccgagctcgcgggcgccgagatcgcgctttttgacatcgacgcc
cagcgcctaaagacctcggaggtcgtcgcgcacaaagtcgccgacgcgctcggcgccaaa
ccccgcatcctcgccaccaccgaccgtgagcgggcgctcgacggcgccgattacgcgctc
aacatgatccaggtcggcgggtacaaacccgcgacgctcatcgacttcgagatccccaaa
aagtacggtctgcagcagaccatcggcgacacgctcggtatcggcggcatcatgcgggcg
ctgcgcaccgtccccgtgcttttggcgatggcgcgcgacatggagcggctctgcccggag
gtactgcacctcaactacgtcaacccgatggcgatcaactgctgggcgctaagccgcgcc
tcgagcgtccgcaccgtcggcctctgccacagcgtgccgcacacggcgggcgagctcgcg
cgcgacctcggcgtgccggtaggtgagatcacctaccgcgtcgcgggcattaaccacgtg
gccttttacctcaccttcgagcgccgcggcgaggacctctacccggcgctccggcggatc
gtcgacgaggggcgggtgcccgagaccaaccgcgtgcgctacgagatgctgcggcggctc
gggtacttcgtcacggagtccagcgagcacttttcggagtacgtgccgtggtttatcaaa
cgcagccacccggaactcgtcgaggcgtttaacatccccatcgacgagtacctgcggcgc
tgcgagtttcagatcgccagctgggagcgcatgcgcgcgcttctcgaggaccccgcgacc
cggttccgggtcgaggacaccgcgagcgagcacaccgaccacacccccacggacggctcg
gtacgcgacgaggcgaggctcaccgagcagctgctcaccatcaagcgctcgccggagtac
ggctctttgatcatccactcgtgtgaaacgggggagccgcgcgtggtctacggcaacgtg
atgaaccgtgggcttatcgacaacctccccgagtgctgcgtcgaggtaccctgtctggtc
gacggcaacggggtgcagccgaccaaggtgggcgcgctgccgccgcagctcgccgcgctg
atgcagaccaacgtgaacgtgcaggcgctcaccgtcgaggccatcttgacggggcgcaaa
gagcacctctaccacgcggcgatgtttgacccgcacacggcggccgaactcagcttggag
gagattcacgacctcgtcgatgacctcttggcggcgcacggcgactgggtgccggaggcg
tttcgccccccgcaccgacgcgagctcgccctgtag

DBGET integrated database retrieval system