KEGG   Truepera radiovictrix: Trad_2000Help
Entry
Trad_2000         CDS       T01254                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tra  Truepera radiovictrix
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tra00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:tra00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2157017..2157775)
Genome map
AA seq 252 aa AA seqDB search
MTENRVALITGGGSGIGRACAEALATSGVRVAVVDVSEGGQAVAEAVGGRFFQADLTERA
ACRRVVEETAAHFGRLDILVNNAGFQHIDPIPDFPEETWDAMLALMLRAPFLLTKYAWPY
LTAAEHGRIVNIASAHALTASPFKAAYVSAKHGLLGLTKVTALEGGPYGLTCNALCSAYV
RTPLVDNQIQDQARTRGISPEEVEQKVLLENVAIKKLLEPEDVAASVVFLCSEAAWGVTG
SAQMLDLGWTAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaccgagtagcgctcatcacggggggcggcagcggcatcgggcgggcgtgc
gcggaggcgctcgctacaagcggcgtccgcgtcgccgtggtggacgtttcagaggggggg
caagcggtcgcggaggcggtcggcgggcggttttttcaagccgacctcaccgagcgagcg
gcgtgccgccgggtggtcgaggagaccgcggcgcactttggcaggctggacatcctcgtc
aacaacgccggctttcaacatatcgaccccatccccgactttcccgaggagacctgggac
gccatgttggctctgatgctccgcgcgccctttttgctcaccaagtacgcttggccctac
ctgaccgccgcggagcacgggcgcatcgtcaacatcgcgagcgcgcacgctcttaccgcg
agcccctttaaggccgcctacgtcagcgccaagcacgggcttttggggctcaccaaggtg
accgccctagagggtggcccctacggcctgacctgcaacgcgctctgctccgcttacgtc
cgcacgcccctggtcgacaaccagatccaggaccaggcccgcacgcgcggcatctcgccc
gaggaggtcgagcagaaggtgctgctcgagaacgtcgctatcaaaaagctcttggagcca
gaagacgtcgccgcctcggtcgtgttcctctgctcggaagcggcgtggggcgtcacgggg
tcggcgcagatgttagatctggggtggacggcgcggtag

DBGET integrated database retrieval system