KEGG   Truepera radiovictrix: Trad_2000Help
Entry
Trad_2000         CDS       T01254                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tra  Truepera radiovictrix
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Trad_2000
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Trad_2000
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Trad_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2157017..2157775)
Genome map
AA seq 252 aa AA seqDB search
MTENRVALITGGGSGIGRACAEALATSGVRVAVVDVSEGGQAVAEAVGGRFFQADLTERA
ACRRVVEETAAHFGRLDILVNNAGFQHIDPIPDFPEETWDAMLALMLRAPFLLTKYAWPY
LTAAEHGRIVNIASAHALTASPFKAAYVSAKHGLLGLTKVTALEGGPYGLTCNALCSAYV
RTPLVDNQIQDQARTRGISPEEVEQKVLLENVAIKKLLEPEDVAASVVFLCSEAAWGVTG
SAQMLDLGWTAR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaccgagtagcgctcatcacggggggcggcagcggcatcgggcgggcgtgc
gcggaggcgctcgctacaagcggcgtccgcgtcgccgtggtggacgtttcagaggggggg
caagcggtcgcggaggcggtcggcgggcggttttttcaagccgacctcaccgagcgagcg
gcgtgccgccgggtggtcgaggagaccgcggcgcactttggcaggctggacatcctcgtc
aacaacgccggctttcaacatatcgaccccatccccgactttcccgaggagacctgggac
gccatgttggctctgatgctccgcgcgccctttttgctcaccaagtacgcttggccctac
ctgaccgccgcggagcacgggcgcatcgtcaacatcgcgagcgcgcacgctcttaccgcg
agcccctttaaggccgcctacgtcagcgccaagcacgggcttttggggctcaccaaggtg
accgccctagagggtggcccctacggcctgacctgcaacgcgctctgctccgcttacgtc
cgcacgcccctggtcgacaaccagatccaggaccaggcccgcacgcgcggcatctcgccc
gaggaggtcgagcagaaggtgctgctcgagaacgtcgctatcaaaaagctcttggagcca
gaagacgtcgccgcctcggtcgtgttcctctgctcggaagcggcgtggggcgtcacgggg
tcggcgcagatgttagatctggggtggacggcgcggtag

DBGET integrated database retrieval system