KEGG   Truepera radiovictrix: Trad_2037Help
Entry
Trad_2037         CDS       T01254                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tra  Truepera radiovictrix
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Trad_2037
Enzymes [BR:tra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Trad_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2195468..2197477
Genome map
AA seq 669 aa AA seqDB search
MSPRPHFPALLHGADYNAEQWLAYPEVLHDDLQLMKDAGVNCVSVGIFAWSMLEPEEGVF
EFGWLDTLMDSLANEDIHVILATPSGARPAWLSERYPEVRQVDATGRRLPHAGRHNHCRT
SPVYREKCGAINRLLASRYATHPALFMWHVSNEYGATPCHCELCYAAFRNWLRKRYGDLE
RLNHAWWTTFWSHRYRCWEEIRPVDPSIQGLMLDWQRFTSDQTLDFFLAESAPLRELTPK
VPITTNFMQPDVGLDYWVFAPHVDVISWDSYPRWHQHGVSDAETAARTAFYHDLHRSYKK
QPFMLMESTPSVTNWQGISRPKRPGLHRLASLQAVAHGSNSVQYFQWRQSRGGEEQFHGA
VVTHQNTADTRVFREVAALGSTLQRLTDVLETNVEAQVAVIYDFQNEWALRWSQLPQNEA
KDYQACCLEHYGALWRQGVATDILCADGELLRYRLVVAPMLYMLREGVAERLEAFVQGGG
TLVMTHTTGLVDAGNLAFLGGFPKPLRRTLGLWVEESDALYPGQEGRIEMLSTSSMSGCY
ISRYVADLLRLETAQPLAHYTCEFYAATPAVTCNAHGAGRAYYLATRLDGRFLNKFYKLL
LSDCGIRTFELPEGVSVSVRQGKDKCTVFVMNFNNAPQSVALESLGLEPVEVGPYGVEVA
TAARQTTSS
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtccccccgaccccacttccccgcgctgttacacggtgctgactacaacgctgaacag
tggctcgcctacccagaggtccttcacgacgacctacagctcatgaaggacgccggggtt
aactgcgtcagcgttggtatctttgcgtggtcgatgctcgagcctgaggagggagtgttc
gagttcggctggctcgacaccctcatggactcgctcgccaacgaggacatccacgtcatc
ctcgcgacacccagcggggcgcgaccagcgtggctctccgagcgctaccccgaggtgcgc
caagtcgacgccacggggaggcgcctgccacacgcgggacgccacaatcactgccgcacc
tcaccggtctaccgcgaaaaatgcggggccatcaaccgcctcctcgcgtcgcgctacgcc
acgcacccagcgctctttatgtggcacgtctcgaacgagtacggcgcgaccccctgccac
tgcgagctttgttacgctgccttccgaaactggttacgtaagcgctacggcgacctggaa
cgtctcaatcacgcttggtggacgaccttctggagccaccgctatcgctgctgggaggag
atccggccagtcgatccttccattcaggggctcatgctcgactggcaacgcttcacgagc
gaccagacgctcgactttttcctcgctgagtcggcaccgctgcgcgagctgacgcctaag
gtacccatcacgacgaacttcatgcaaccggacgtgggacttgactactgggtgttcgca
ccccacgtcgacgtcatctcttgggactcgtatccgcgctggcaccagcacggcgtcagc
gatgcagaaacagccgcacgcactgccttttatcacgacctacaccgctcttacaaaaag
cagccctttatgctcatggaatccacgccgtcggtgacgaactggcaggggataagccgc
cccaagcggccagggttgcaccgactcgcctcgctgcaagcggtggcacacggctcgaac
agcgtgcaatattttcagtggcgacagagccgtggcggtgaggaacagttccacggggca
gttgtcacgcatcagaacactgcagacactcgcgttttccgtgaggtggctgcgctcgga
agcacactccagaggcttacagacgtgctcgagacaaacgtcgaggcacaggtagccgtc
atctatgatttccagaacgagtgggcactaaggtggtctcaactcccccaaaacgaagcc
aaggattaccaggcctgctgtctagagcactacggggcgctgtggcggcagggagtagcg
accgatatcctctgcgccgacggcgagctgttacgctaccggctcgtcgtagcgcccatg
ctctatatgctgcgcgagggggtcgcagagcggcttgaggcctttgtacaggggggtggc
acactagtcatgacccacaccacagggctcgtggatgcaggtaatcttgcctttcttggt
ggcttcccaaaaccactacgccggacactcgggctctgggtcgaggagagtgatgccctc
tatccaggccaggaagggcgtatcgagatgttgtccacctccagtatgagcgggtgttat
atctcgcgctatgtcgctgacctccttcgcctcgagactgctcagccgctcgcacactac
acctgcgaattctacgcggccaccccagcagtgacctgcaacgcgcacggcgcggggcgc
gcttactatctcgccacgagactcgatgggaggtttttaaataagttttataaactactc
cttagtgactgtggcataaggacgttcgagctgcccgaaggggtgtcggtgtcagtacgc
caaggaaaggataagtgcaccgtattcgtcatgaatttcaacaacgcgccgcagagtgta
gcgctcgaatcgctcggcttggaacctgtggaggtaggcccctacggcgtagaggtggcg
acggctgcgcgccaaactacctcctcgtga

DBGET integrated database retrieval system