KEGG   Truepera radiovictrix: Trad_2103Help
Entry
Trad_2103         CDS       T01254                                 

Definition
glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tra  Truepera radiovictrix
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2278302..2280425)
Genome map
AA seq 707 aa AA seqDB search
MLVKLPNPRLGYLALVMLVAAACATQSPSLEQAAAPTPPKTEERCGYTLSLDVRANPAGR
FQGQLQLTNRSGEPATAFVLRLSFAEEADLISTQGGVFQREADGGYLVSAPRQLSRAPLR
QGRTHRLGFAGRGSAEGVRAELLSINGRTCTPRERFVGNIWPNDTQDDPTFATYWNQVTP
ENAGKWGSVEAERGVMKWTDLDRAYAYAKEQAFPFRLHTLVWGSQQPAWLAGLSQAEQLE
ALESWMRQLAERYPDIDFIDVVNEPLHETPSYKEALGGDGATGWDWVIRAFELARAYFPE
AELHLNDYNILFRRESTEQYLEIVALLQERGLIDGIGEQGHFLERTDLQTLRENLDLLAA
TGLPIYITELDVNFANDAQQANRLAELFPVFWEHEAVAGVTFWGYKENQIWRTDAYLLRA
DGSERPALVWLRCYLAGNRDCPVPEYVPQPRVGDEVRLRIEAEDYDDAQGIVSAGDIIAY
IDAGDWVLYRNAQLRSDYNVLRIRYAKGSEAAGTLALRLGSLEAAATISVEIPSTGSWGT
FTTLEVPLPPLEGAYDLFFTFHDVDAFGNFDYFEFGRSGRVGTEARLELEAESFDEQSGT
EVYGSFVGNADDGDWLLFRGVEVRSSYTRFEATYARDAVGGLVEVRVGALDGPLAASFEP
ESTGGWNTFATLSTEFSAEAGPQDLYVLFTGSEGLGNFDRFALVSGE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgtgaagttgccaaacccccgtctcggttatctcgctttggtcatgttggtggcc
gctgcctgcgccacccaatccccttcgctcgaacaggcagctgcgcccaccccccctaaa
accgaggaacgctgcggctacaccctgtcgctagatgtcagggcgaacccagcaggccgc
ttccaggggcagctacagctcaccaaccgctcgggcgagcccgcgacggcctttgtccta
cggctcagctttgccgaggaagcggacctcatcagcacccaagggggcgttttccagcgg
gaggcagatggtggctacctcgtgagcgcgccccgccagcttagccgcgccccgctgcgg
caggggagaacgcaccgccttggtttcgcgggccgtggcagcgccgagggcgtgcgggcc
gagctgctaagtatcaacggccgcacctgcacgccgcgcgagcgctttgtcggcaacatc
tggcccaacgacacgcaagatgatcctacttttgcaacctactggaaccaggtaacccca
gaaaatgcgggtaagtggggtagcgtcgaagccgagcgcggcgtgatgaagtggaccgat
ctcgaccgcgcctacgcctacgccaaggagcaagcctttcccttccgcctacacacgctg
gtgtggggcagtcagcagccggcgtggctcgctgggctttcgcaagcagagcagcttgag
gcgcttgagagctggatgcgccaacttgctgagcgctacccagatatcgactttatcgat
gtcgtcaacgaaccccttcatgaaacccctagctataaagaggccctcggtggcgacggt
gcaacgggttgggactgggtgattcgcgcctttgagctggcgcgcgcgtactttccagaa
gctgagctgcacctcaacgactacaatatcctttttaggcgggaaagtaccgagcagtac
ctggagatcgttgcgctgttacaggagcgcggtttaatcgacggcatcggggagcaggga
cactttctcgagcgcaccgacctgcaaacccttcgcgagaacctcgacctgctcgccgcg
acggggctgcccatctacatcaccgagctcgacgttaactttgccaacgacgcgcagcaa
gccaaccgcctagcggagctgttcccagtcttctgggagcacgaggcggtcgccggcgtc
accttttggggttacaaggagaaccaaatttggcgcaccgacgcctatctcctgcgcgcc
gacgggagcgaacgccccgctttggtgtggctgcgctgctatctagcgggcaaccgtgac
tgccctgtgcccgagtatgtaccgcaaccccgcgtaggtgatgaggtgcggttgcgcatc
gaagcggaggactacgacgacgcgcaggggatcgtctcggcgggcgacatcatcgcctac
atcgacgcgggcgactgggtgctctaccggaacgcacagcttcgtagcgactacaacgtg
ctccggatacgctacgccaaaggttctgaggcggccggcaccctcgcgctcagactcggc
agcctcgaggcggccgcgaccatcagcgtcgagattccgagcacggggagctggggcacc
ttcaccacgctcgaggtcccgctgcccccgctcgagggtgcttacgacctcttcttcacc
tttcatgacgtcgacgcgtttggcaacttcgactacttcgagtttggccgcagcggtcgc
gtcggcaccgaggcgcgcttggagctcgaggccgagagcttcgatgagcagtcgggcacc
gaggtctacggcagctttgtcggcaacgccgacgacggcgactggctgctctttcgaggt
gtcgaggtgcggagctcgtacacccgcttcgaggcgacctacgcgcgcgacgccgtcggc
ggcctcgtcgaggtccgggtgggcgcgctggacggtccgctcgccgcaagcttcgagccc
gaaagcaccggtggttggaacaccttcgctaccttaagcaccgagttctccgccgaggca
ggtccgcaggacctctacgtcctcttcacgggcagcgagggtctcggcaactttgaccgc
ttcgcgctagtgagcggtgagtaa

DBGET integrated database retrieval system