KEGG   Truepera radiovictrix: Trad_2292Help
Entry
Trad_2292         CDS       T01254                                 

Definition
L-fucose isomerase
Organism
tra  Truepera radiovictrix
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2491485..2493104)
Genome map
AA seq 539 aa AA seqDB search
MDDLQPTLPITHALLVASGDLRETANRVCWPAQAAMEAALTEAFGRHGVKVTRAHPFDER
TGHGFISSQRMGMDVFRTVPKDAPLVVAEAVWQYSHHVLAGLRDHRGPILTVANWSGQWP
GLVGMLNLNGSLTKAGVAYSTLWSETFTDPFFERGLKEWLTTGRVEHDLSHVRSLEPSAL
SAEAAELGAHLAETLRRDKAILGVFDEGCMGMYNAIIDDELLNPLGVYKERLSQSALVAE
MRLVRGSEARSVLDWLRRRGVTFVTGTDDETELTEAQLLEQARMYVAAVRMAHRFGCDAV
GIQYQQGLKDMTPASDLVEGLLNNPDRPPVLHAETGEELYPGRALPHFNEVDECAALDAL
VTNRVWTALSLEPSTTLHDLRWGEPYPIAGEEPFVWVFEISGAAPASHFVDGYAGARSER
QPPMYFPLGGGTLKGVSKPGEIIWSRVFVQGGALEVDLGRATVVALPEEETRRRWEATTP
QWPIMHAVLRGVTRDQMMARHKANHIQVAYVPSEQAEHVLQVKAAMFAALGLKVHLCGV
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctgcaacccacgctgcccatcacccacgccctcttggtcgcgagcggcgac
ctgcgcgagacggccaaccgcgtctgctggcccgctcaggcggcgatggaggcggcgcta
acggaggctttcgggcgccacggcgtcaaggtgacgcgcgcccaccccttcgacgaacgc
accggccacggctttatctcgtcgcagcgcatggggatggacgtgtttcggacggttccc
aaagatgccccgttggtcgtcgccgaggccgtgtggcagtactcgcaccacgtcctggcc
ggtctgcgcgaccaccgggggccgatcctcacggtcgccaactggagcggccagtggccg
gggctggtggggatgctgaacctcaatggctccttgaccaaggcgggggtcgcctacagc
acgctgtggagcgagaccttcaccgacccctttttcgagcgcgggctcaaggaatggttg
acgacgggaagggtcgagcacgacctcagccacgttaggtcgctcgagcccagcgccctc
tcagcggaagcggccgagctgggcgcccacttggccgagaccttgaggcgcgacaaggcc
atcttgggcgtgttcgacgagggctgcatggggatgtacaacgccattatcgacgacgaa
ctcctcaaccccttgggcgtctacaaggagcgcctgtcgcagtcggccttggtcgccgag
atgcgcctggtgcggggcagcgaggcgcgctccgtcctcgactggttgcgccggcgcggc
gtgaccttcgtcacgggaacggacgacgagaccgagctgaccgaagcgcagcttctggag
caggccaggatgtacgtcgccgccgtgcgcatggcccaccgcttcggttgcgacgccgtg
ggcatccagtaccagcagggcctcaaagacatgacgcccgcttctgacctcgtcgaaggg
ctgctcaacaaccccgaccgcccccccgtgctgcacgccgagaccggcgaggagctctat
ccgggccgcgccctgccgcacttcaacgaagtcgacgagtgcgccgccttggacgctctt
gtcaccaaccgggtgtggacggcgctctcgctcgagccctcgaccacgctgcacgacctg
cgctggggcgagccctacccgatcgctggggaggagccgttcgtttgggtgtttgagatc
tccggcgcggcccccgcctcgcacttcgtagacggctacgcgggggcgcggagcgagcgg
cagccgcccatgtactttcctttggggggcggaacgctcaagggggtcagtaagccaggt
gagatcatctggagccgcgtgttcgtgcaggggggcgctctagaggttgacctcgggcgg
gcgacggtggtcgcgctccccgaggaggagacgcggcggcggtgggaggcgacgacgccg
cagtggccgatcatgcacgcggtcttgcgcggcgtcacgcgcgaccagatgatggcgcgg
cacaaagccaaccacatccaggtggcctacgttccgtccgaacaagctgagcacgtgttg
caggtcaaagcggcgatgttcgccgcgttggggcttaaggttcacctgtgtggggtgtga

DBGET integrated database retrieval system