KEGG   Truepera radiovictrix: Trad_2329Help
Entry
Trad_2329         CDS       T01254                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tra  Truepera radiovictrix
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trad_2329
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trad_2329
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Trad_2329
Enzymes [BR:tra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Trad_2329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2536547..2537767
Genome map
AA seq 406 aa AA seqDB search
MFPLPDSRGRYGAFGGRFVPETLIPALDDLTRAYRDASADPAFRRAFEHYLKTFVGRPST
LYLAENLTKHCGGAKIYLKREDLNHTGAHKINNTVGQALLAKRLGKERVIAETGAGQHGV
ATATAAALFGLKCVVYMGAEDVRRQALNVFRMKLLGAEVREVTSGTHTLKDATNEAIRDW
VTNVRDTFYIIGSVVGPHPYPMMVRDFQSVIGFETMAQLEAQEGRRVPDAVVACVGGGSN
AIGLFAPYAYLPDGERPKLYGVEAAGHGMASGAHAASITAGKKGVLHGALMYLMSDEDGQ
IRPAHSVSAGLDYPGVGPEHSYYADAGLAEYVGVDDAQALEAFEALSRIEGIIPALETAH
AVFYAMQLARAMRPEELIVVNLSGRGDKDVTEAMRVMKLQENREQN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgttccccctacccgacagccgcgggcgttacggcgcgttcggtgggcgcttcgtcccc
gaaacgctgatccccgcccttgacgacctgacgcgcgcgtaccgcgacgcgagcgccgac
cccgcgtttcggcgcgcgttcgagcactacctcaagaccttcgtggggcgcccgagcacg
ctctacctcgccgagaacctgaccaaacactgcggcggcgccaagatctaccttaaacgc
gaggacctcaaccacacgggcgcgcacaagatcaacaacaccgtcggccaggcgctgctc
gccaagcgcctcggcaaggagcgcgtcatcgccgagaccggcgcggggcagcacggcgtc
gccacggcgaccgccgcggccctctttggccttaagtgcgtcgtctacatgggcgcggag
gacgtacgccgccaagccctcaacgtcttccggatgaagctcctaggcgccgaggtgcgc
gaggtcaccagcggcacccacaccctcaaagacgccaccaacgaggccatccgcgactgg
gtgacgaacgtccgggacaccttctacatcatcggctcggtcgtcggcccgcacccgtac
cccatgatggtgcgcgactttcagagcgtgatcggctttgagacgatggcgcagcttgaa
gcgcaggagggccgccgcgtgcccgacgccgtggtcgcgtgcgtcggcggcggttcgaac
gccatcgggctctttgcgccgtacgcctatctccccgacggggagcggcccaagctctac
ggggtcgaggcggcggggcacgggatggcctcgggcgcccacgccgcgagcatcacggcg
ggcaaaaagggtgtgttgcacggcgccctgatgtacctcatgtcggacgaggacgggcag
atccggcccgcgcactcggtctcggcggggctggactaccccggcgtcggcccggagcac
tcgtactacgccgacgccgggctcgccgagtacgtcggcgtcgacgacgcgcaggccttg
gaggcttttgaagcgctcagccgcatcgagggcatcatccccgcgttagagaccgcccac
gcggtgttttacgccatgcagctcgcccgcgcgatgcgacccgaagagctcatcgtcgtc
aacctctcggggcgcggcgacaaggacgtcaccgaagcgatgcgcgtcatgaagctgcag
gagaaccgtgagcagaattga

DBGET integrated database retrieval system