KEGG   Truepera radiovictrix: Trad_2330Help
Entry
Trad_2330         CDS       T01254                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tra  Truepera radiovictrix
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Trad_2330
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trad_2330
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Trad_2330
Enzymes [BR:tra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Trad_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2537754..2538557
Genome map
AA seq 267 aa AA seqDB search
MSRIERAFERARAEGRAAFIPFLTAGFPDERRFLAEARALLEVADVLEVGLPYSDPLGDG
PTIQRASERALAQGMTTRKTFELVAELRAQSDKAIVLMTYYNPIYCYSHGARGEAGFVAD
LKAAGADGVILPDLPPDEADTLLPAARAAALDTIFLVAPTSTDARLKLVTAACRGFVYAV
SVTGVTGARAALPEDVPNLVRRTKAVSDLPVAVGFGVAHAQSARAVAAVADGVVVGSALI
GALERGEALAPLARELAAACSKEVTAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaattgagcgcgcgttcgagcgcgcgagagccgaaggccgcgcggcctttatc
cccttcctaacggctggttttcccgacgaacggcgttttctggcggaggcgcgcgcgctt
ttagaggtcgccgacgtgctcgaggtcggtctcccctactccgaccccttgggcgacggc
ccgaccatccagcgcgcctcggagcgcgccctcgcgcaggggatgaccacgcgcaaaacg
tttgagctcgtcgccgagctgcgcgcgcagagcgacaaggccatcgtgctgatgacctac
tacaaccccatctactgctacagccacggggcgcggggcgaagcgggtttcgtggccgac
ctcaaggccgcgggcgccgacggcgtgatcctccccgacctcccccccgatgaggccgac
acgctcctgcccgcagcgcgcgccgcggcgctcgacaccatcttcctggtcgccccgacc
tccacggacgcgcggctaaaacttgtcaccgcagcgtgccgcgggtttgtctacgcggtc
tcggtcacgggggtgacgggggcgcgcgcggcgctccccgaggacgtccccaacctcgtg
cggcgcaccaaggcggtgagcgacctgccggtggcggtcggcttcggggtagcacacgcc
cagagcgctcgagccgtcgcggcggtcgccgacggcgtggtggtcggctcggcgctgatc
ggcgccttggagcgcggcgaggcgttggcgccgctcgcgcgcgagctcgcggcagcgtgc
agcaaagaggtcacggcgccttag

DBGET integrated database retrieval system