KEGG   Truepera radiovictrix: Trad_2376Help
Entry
Trad_2376         CDS       T01254                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tra  Truepera radiovictrix
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Trad_2376
DNA repair and recombination proteins [BR:tra03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Trad_2376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2599425..2600015
Genome map
AA seq 196 aa AA seqDB search
MRYPPALTQLIRELGRLPGIGPKSAQRLAFYLFNQPEEDVKSLAEALLNAKGNLRQCERC
FNITDQEVCSVCRDPGREQGLICVVEAPADLLAIERSGEYSGLYHVLHGALSPMNGVGPD
QLTIQPLLARLGGVREVILATATTVEGEATAMYLARLLGELKVPTSRIAYGLPVGGDLEY
ADEVTLGRAISNRRPL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacccccccgctttgacccaactcatccgcgagctcggccgcctccccgggatc
ggccccaagagcgcccagcggctcgcgttttacctctttaaccaacccgaagaggacgtt
aaaagcctcgccgaggcgctcctcaacgccaagggcaacctgcggcagtgcgagcggtgc
tttaacatcaccgaccaggaggtgtgcagcgtctgccgcgacccggggcgtgaacagggt
cttatctgcgtcgtcgaggcgcccgccgacctgctcgccatcgagcgtagcggcgagtat
agcgggctctaccacgtgctccacggggcgctctcaccgatgaacggcgtcgggccggac
cagctgaccattcaaccgctgctcgcgcgcctgggcggggtgcgcgaggtgatcctcgcg
accgccacgaccgtcgagggggaggcgaccgcgatgtacctcgcgcgtcttttgggtgaa
ctcaaggtgccgacctcgcggatcgcctacgggttgccggtcggcggcgacctcgagtac
gccgacgaggtcaccctgggccgcgccatcagcaaccggcgcccactctag

DBGET integrated database retrieval system