KEGG   Truepera radiovictrix: Trad_2547Help
Entry
Trad_2547         CDS       T01254                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tra  Truepera radiovictrix
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Trad_2547
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Trad_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2771625..2772572
Genome map
AA seq 315 aa AA seqDB search
MTKFFVVGDVTVDQMYFVNALPEPGGEVTASRAVLEPGGAGGTIAAALARLGNEVVLAAR
VGEGPFAELALKHVRRAGVDLSLIQTDPTHQTSSVTLLITPDTQRTMIAGGGASRHLDAS
KLRDEHVASCDALVVSAYSLVGGMQREYAVRALEIAKRERLTTFIDMGSGAADALRERLL
ATIQDVDYLLMNRRELFALTGESSISAAVAGLAERSIQRVLVKLGEMGSMVITPELTELV
EALEIDGVVESTGAGDYYTAAFAHGVMEGYDLHYAARLGNVAGALNVTAVGAQSCEIDAP
TLYRYAEQMLAVEPA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactaagttttttgtggtgggtgacgtgaccgttgaccagatgtacttcgtcaacgcc
ctgcccgagccgggcggcgaagtgaccgcgagccgcgcggtgctcgagccggggggggcg
ggcggtaccatcgcggcggcgctcgcacgcctcggcaacgaggtcgtgctcgccgcgcgc
gtcggcgaggggcctttcgccgaactggcgcttaagcacgtgcggcgcgccggcgtcgac
ctcagcctgatccagaccgaccccacccaccagacgagcagcgtcacgctccttatcacc
cccgacacccagcgcacgatgatcgcgggcgggggtgcgagccgccacctcgacgcttcc
aagctgcgcgacgagcacgtcgcgagctgcgacgcgctggtggtgagcgcctacagcctg
gtgggtgggatgcagcgcgagtacgccgtgcgcgccctcgagatcgccaagcgcgaacgc
ctcacgacctttatcgacatgggttcgggggccgccgacgcgctgcgcgaacgcctccta
gcgaccattcaagacgtcgactacctgctgatgaaccgccgcgagctcttcgcgctgacc
ggggagagctccatctcggcggcggtcgcagggctcgccgaacggagcatccagcgcgtg
ctcgtcaagctcggcgagatggggtcgatggtgatcacccccgaactcaccgagctcgtc
gaggcgctcgagatcgacggggtcgtcgagtcgaccggcgcgggcgactactacaccgcc
gcgttcgcccacggcgtgatggagggctacgacctgcactacgccgcgcggctcggcaac
gtcgcgggcgctttaaacgtcaccgccgtcggcgcgcagagctgcgagatcgacgcgccg
acgctctaccgctacgccgaacagatgctcgccgtcgaaccggcgtag

DBGET integrated database retrieval system