KEGG   Truepera radiovictrix: Trad_2687Help
Entry
Trad_2687         CDS       T01254                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tra  Truepera radiovictrix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Trad_2687
Enzymes [BR:tra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Trad_2687
Exosome [BR:tra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Trad_2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2920659..2922299)
Genome map
AA seq 546 aa AA seqDB search
MVEFTLFAPYNEEAALIAEFTDWEPLAMTRGEDGVFRVQVPLADGTYRYKFRVRSKSWFF
EEGAWVDVVDPYATAIDHEGGENGVVRVRGGERYVDDYAWQHDEAHLPPDHALAIYELHV
ADFSGGEDDAHERGDFRHVEEKLDYLQELGVNALELMPVQAYPGDHSWGYNPRHFFAVHP
GYGTSEDLKRLVDACHGRGMRVILDMVLNHSESESPLTQIDHDYWYHHEPTDPNNTWGPE
FNYEKYDESLGTFPARKFAGDLVRFWVEEYHIDGIRFDAAKHIASHDFMTWVVGEAKRAA
GVKPFYTIAEHIPEVPEIVGQEGPMDGCWHNGFYHGITAHLKGERFDLDELKGLLDGRRK
GFTGPTALVNYIASHDHGHLMAVLAEAGIHDAEAFRRAKLGAALTFTALGVPMLWMGSEF
GEYKKKQLEEAKIDWPLLANEANRGLFAYHQGLVALRKEQGALQTENLEFIHENDEARVL
AFKRWDEGGSQVVVVANLSDQHHASYCVPGLGSGTWHEWTKDYDTDVAGELTLELGPWEA
QVFVKR
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggtggaattcaccctgttcgccccttacaacgaagaggcggccctcatcgccgagttc
acggactgggaaccgctcgcgatgacgcggggtgaagatggggtctttcgcgtgcaggtg
ccgctagcagatggcacctaccgctacaagttccgcgtccgctcgaagagctggtttttc
gaagagggcgcgtgggtggacgtcgtcgacccctacgcgacggccatcgaccacgagggt
ggcgaaaacggtgtggtgcgcgttcgcgggggggagcgctacgtcgacgactacgcgtgg
cagcacgacgaggcgcacctgccgccggaccacgcgctcgccatctatgagctgcacgtc
gccgacttctcagggggtgaagacgacgcgcacgaacgcggcgactttaggcacgtcgag
gagaagctcgactatttgcaagagctcggcgtaaacgcgctcgagctgatgcccgtgcag
gcctaccccggcgaccactcgtggggttacaacccgcgccacttcttcgccgtccatccc
ggttacggcacctcggaggaccttaagcgcctcgtggacgcctgtcacgggcgcggtatg
cgcgtgattttagacatggtcctcaaccactcggagtccgagagccccctgacgcagatc
gaccacgactactggtaccaccacgaaccgaccgaccccaacaacacctggggacccgag
ttcaactacgaaaagtacgacgagtccctgggcaccttcccggcgcgcaagttcgcgggc
gacctggtacgcttctgggtcgaggagtatcacatcgacggcatccgcttcgacgccgct
aagcacatcgcttcgcacgactttatgacgtgggtggtgggtgaagcgaagcgcgcggcg
ggtgttaaacccttctacaccatcgccgagcacatccccgaggttccggagatcgtcggc
caagaggggccgatggacgggtgttggcacaacggcttctatcacgggattacggcccac
ctcaaaggcgagcgcttcgacctagacgagctcaaagggctgctggacggtcggcgtaag
ggtttcacggggccgacggctttggtcaactacatcgcctcgcacgaccacgggcacctg
atggcggtgctcgccgaggcgggaattcacgacgccgaggcctttcggcgggcgaagctg
ggggccgcgttgacctttaccgcgctcggcgtcccgatgctctggatggggagcgagttc
ggtgagtacaaaaagaagcagctcgaggaggccaagatcgactggccgctgctggccaac
gaggccaacagggggctatttgcgtatcaccaagggctggtagccttgcgtaaagagcag
ggggcgctgcagaccgagaacctcgagttcattcacgaaaacgacgaggcgcgcgtgctc
gcctttaaacgttgggacgagggcggctcgcaggtcgtcgtggtcgccaacctctcggac
cagcatcacgcatcgtactgcgtaccggggcttggcagcggcacctggcacgagtggacc
aaagactacgacacggacgtcgcgggggagctgacgctcgagctcgggccgtgggaggcg
caggtgttcgtcaagcgctag

DBGET integrated database retrieval system