KEGG   Truepera radiovictrix: Trad_2828Help
Entry
Trad_2828         CDS       T01254                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tra  Truepera radiovictrix
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Trad_2828
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Trad_2828
Enzymes [BR:tra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Trad_2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3068222..3069736
Genome map
AA seq 504 aa AA seqDB search
MKLAHLIRAALGPDATWSHLPLPEVEVRRIVQDTRELTPSDPATEPFIFVARRGAAVDGH
RFAARAVAQGAVAVVGEATPEEQASFAWRHAAPYIQVPDDRAALAQLAATLYGHPSRALF
TVGVTGTDGKTTTATLLHHLLQGDRPTGLLSTAGVRLGEAEGGLFGHFTTPEAPEVQRTL
AAFVARGLRAAVIESSSHGFAQRRLDAIDYDLGILTNLSPEHLDFHGTFENYRAAKAQLM
ARARTSILNADDPNYAYFAARARRIITYGVVRAATWRATEVRELPGALEWRLTHAGRSYP
ARLPMVGSYNVYNALAALAAACEAGVPLAGALARLATFPGVPGRMQVVQTAPFALVVDFA
HTPPALEKALAALRPQVRGKLIVVVGAAGERDPGKRAPLGAAAARGADLAVFTEEDARSE
DPEAILAQLRAGAQGAGGRLGETFWLEPDRRAAIRRAVTLAEAGDLVLLAGKGHERTLER
RDETLPWDEVAEARRALAERGLGP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcgcccacctcatccgcgccgccctcggccccgacgccacctggtcgcacctc
ccgctgcccgaggtcgaggtgcgccgcatcgtccaggacacgcgggagctcacgcccagc
gacccggctaccgaacccttcatcttcgtcgcgcggcgcggcgccgccgtcgacgggcac
cgcttcgccgcgcgcgccgtcgcgcagggggccgtcgcggtcgtcggcgaggccacgccg
gaggagcaggcgagcttcgcgtggcgccacgcggcgccctacatccaggtccccgacgac
cgcgcggccctggcccagctcgccgccaccctctacgggcacccctccagagcgctcttt
accgtaggcgtcacgggcaccgacggcaagacgaccaccgccacgctgctgcaccacctg
ctgcagggggaccggccgacggggctgttgtcgaccgcgggggtccggttgggggaggcg
gagggggggctcttcgggcacttcaccacccccgaggcgcccgaggtgcagcgcacgctc
gcggcgtttgtcgcgcgcggtctgcgcgccgcggtgatcgagtcgagctcgcacgggttc
gcgcagcggcggctcgacgccatcgactacgacctcggcatcctcaccaacctctccccc
gagcacctcgacttccacggcaccttcgagaactaccgcgcggccaaagcgcagctcatg
gcgcgcgccaggacgagcatcctcaacgccgacgaccctaactacgcgtacttcgcggcg
cgcgcgcggcggatcatcacctacggggtggtgcgcgccgcgacctggcgcgccaccgag
gtgcgggagctgccgggggcgctcgagtggcgcctcacgcacgccggccgcagctacccc
gcccgcctccccatggtggggagctacaacgtctacaacgcgctcgccgcgctcgccgct
gcctgtgaagcgggggtgcccttggcgggggcgctggcgcgcctcgcgacctttcccggc
gtgccggggcggatgcaggtggtgcaaacggcgccctttgcgctcgtggtcgacttcgcc
cacaccccccccgccctcgagaaggccctcgcggcgctccggccgcaggttcggggcaag
ctgatcgtggtcgtcggcgcggcgggcgaacgcgaccccggcaaacgcgcacccctcggc
gccgccgccgcgcggggcgccgacctcgcggtcttcaccgaggaggacgcgcgctcggag
gacccagaggcgatcttggcgcagctgcgcgcgggcgctcaaggggcgggggggcgcctc
ggggagacgttctggctcgagcccgaccgccgcgcggccatccggcgggctgtgacgctc
gccgaggcgggcgacctcgtgctcttagcgggcaaggggcacgaacggacgctcgagcgc
cgcgacgagacgctcccctgggacgaggtcgccgaggcgcggcgcgcgctcgcggagcgg
ggtctaggcccctag

DBGET integrated database retrieval system