KEGG   Thermocrinis ruber: THERU_06080Help
Entry
THERU_06080       CDS       T03001                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
trd  Thermocrinis ruber
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:trd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THERU_06080
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    THERU_06080
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    THERU_06080
Enzymes [BR:trd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     THERU_06080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
complement(1105814..1107385)
Genome map
AA seq 523 aa AA seqDB search
MLTRREFISVPLLCLLTRNLEAFASDTPEVFPQGVASGDPTQDSVVLWTRIEPKVHESMK
RDLVLEISTKPDFSEVVQVRIPADRINPSRDYTVKLTIDGLKPGGTYYYRFVYADVPSLT
GRFKTLPAGSPEEFRFAFITCQNYADGYYSAFRHISQEDVGFVVHLGDQIYEKIYGPPRV
PGRDLNLPSGGRIALTLEDYLYLYRTYLSDKDYQLARAMHPFIYIWDDHEYANDYSYDYE
GGYYLLPRHPFYRKKAQSLALRRIAIQAWLAYTPAKVKVDLDSRDPLKWITIYRDFKVGD
LLHLICTDERSYRTPQPCEKRFAHPGCPEQRKTSMLGKEQKTWLFRKLEEKGYNWKVWAN
EVQFVQGRVNGLFGSLDAWDGYAGEREEILRFLGSKAINNLVIITGDRHAGLVAEVPDKF
EGDYQKVLGMEFMTPALSSISAAETTWWRDYGVSNHVEFAQAEKNQNPWTKYIEHKIWGY
SVLTLTRDRAVGEMFFVDKYRKDAEKVRAVRAVYERGKPITLL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaagaagagagttcataagcgtgcctctgctgtgcttacttaccagaaacttg
gaagcctttgccagtgacacacccgaagtctttcctcagggcgtcgcaagcggagaccct
acccaggacagcgtagtgttatggacaagaattgagccaaaggtgcacgaaagtatgaaa
agggacctggtgcttgagatatccacaaagcctgacttttcggaggtggtccaagttcgc
atacctgcagacagaataaacccctcaagggactacacagtaaagcttaccatagatgga
ttaaagccaggtggcacctactactaccgctttgtgtatgcagatgttccatctctaacg
ggaaggttcaaaacactgcctgcaggaagcccggaggagtttaggtttgcttttatcacc
tgccaaaactatgcggatggctactactccgcctttaggcacatttcccaagaggacgta
ggttttgtggtgcatttgggagaccaaatttacgagaagatctacggaccgcctagggtg
cccggaagggatctgaaccttccctccggtggaagaatagccctcaccttggaagactac
ctgtacctatacagaacctatctttctgacaaggactatcagcttgcccgtgccatgcat
cctttcatatacatctgggatgaccacgagtacgccaacgattactcctatgactacgag
ggaggctactacctattgcccagacatcccttttacaggaaaaaagcccagagcttggca
ctaaggaggatagccatacaggcatggcttgcctacacacccgccaaggtaaaggtagac
ctagattcaagggatccattaaagtggataaccatatacagggactttaaggtgggagac
cttcttcacttgatatgcaccgacgagaggtcctacaggacgcctcaaccttgtgaaaag
agatttgcacacccaggctgtcccgaacagagaaaaacctctatgctgggaaaggaacaa
aaaacttggttgttcagaaagctggaggaaaaaggctacaactggaaagtttgggcaaac
gaggttcagtttgttcagggtagggtcaacggactctttggttccttggatgcttgggat
ggctacgcaggagagagggaggagatcctcaggtttttagggtcaaaggctataaacaat
ctggttatcataacgggagacaggcatgcggggctagtggcagaggttccagacaagttt
gaaggagactatcaaaaggttcttgggatggagtttatgacgccagccctttcctccata
agtgccgcagagaccacctggtggagagattacggcgtgtcaaaccacgtggagtttgcc
caggcggaaaagaaccaaaacccttggactaaatatatagaacataaaatctggggctac
tcggtccttacgcttacaagggatagggctgtaggagagatgttcttcgtggataagtac
aggaaggatgcggaaaaagtaagggcagttagggcagtttatgaaagaggaaagccgata
actttgctgtaa

DBGET integrated database retrieval system