KEGG   Trichoderma reesei: TRIREDRAFT_105504Help
Entry
TRIREDRAFT_105504 CDS       T02991                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tre  Trichoderma reesei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TRIREDRAFT_105504
Enzymes [BR:tre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TRIREDRAFT_105504
Exosome [BR:tre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRIREDRAFT_105504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 565 aa AA seqDB search
MPSERHPLLSNRGESAEIAQQKAALRSSRIREIAFFAWGLLATAAFIVAAVWIQHDAQTD
HGNHDKVAPKRNLVFMVSDGMGPASLSLTRSYRQYINDLPENDTLVLDQHFWGTSRTRSS
NSLVTDSAAGATAFSCGLKSYNGAISILPDFEPCGSVMEAAKRVGYTTGLVVTTDITDAT
PATFVSHVLRREMQDSIALQEIGEGVLGRSVDLMLGGGRCHFLPNSTEGGCRADEVDVTR
LAREKHGWGYTDDRHGFDALDGGNKVKLPFLGLFAERDVPFEIDRQKQNDVYPSLSEMAT
TALRALEKATKDTDKGFFLMIEGSRIDHAGHFNDPAAQVREVLEYDKTFKAVLDFIANSK
TETVLVATSDHETGGLATAIQEPGHLPVYNWYPRALANAASSTEYLASKLRSYAASIGHF
NNPKERRKSKASLKKWINEELVVPGLGISNASDEELEALADNAEASLEIFSAMISLRAHV
GWSTHGHTAVDVNIYSSGGPGTQAIRGNVENTDVGKFLRHYLDVDDVVEDITKELREKTE
KPGEGAMSMALEGGSVVGSYHAQEI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccgagcgtcatcctctcctatccaaccgcggcgagtccgccgaaatcgcccag
caaaaggcggccctgcgctcttcacgcatccgcgagatcgccttctttgcatggggcctt
ctagcaacagccgccttcatcgtcgccgccgtctggatccagcacgatgcgcagaccgat
cacggcaaccacgacaaggtcgccccgaagcggaacctcgtcttcatggtgtccgacggc
atgggcccagcctcgctctccctgacgcgcagctaccgccagtacatcaacgaccttcct
gaaaacgacacgctcgttttggaccagcacttctggggtaccagccgcacccgctccagc
aactccctagtcaccgacagcgctgccggcgccactgccttctcctgcggcctcaaaagc
tacaacggcgccatctccatcctgccagactttgagccgtgcggatccgtcatggaggct
gccaagagggtcggctacacgacaggcttggttgtcaccaccgatatcacagatgccacg
cccgcgacctttgtcagccacgtcctacggcgagagatgcaggactcgattgctctgcag
gagattggcgagggtgtcttgggccgttccgtcgacctcatgctcggtggaggccgctgc
cacttcctgcccaactccaccgagggcggatgccgtgcggatgaggtagacgttacgcga
ctggctcgggagaagcacggctggggctataccgacgaccgccacggcttcgacgctctc
gacggcggcaacaaggtcaagcttcccttcctcggcctctttgccgagagggacgtgccg
ttcgagattgatagacagaagcagaacgatgtgtaccccagcctgagcgagatggccacc
acagccctgcgggctctcgaaaaggcgaccaaggacacggacaagggcttcttcctcatg
attgagggcagccgcatcgaccatgctggccacttcaacgaccccgctgcccaggtccgc
gaggtactcgaatacgacaagacgttcaaggccgtcctcgacttcatcgccaacagcaag
acggagacggtgctcgtggccaccagcgaccatgaaaccggcggtcttgccactgccatt
caggagcccggccatctgccggtatacaactggtaccctcgcgccctggccaatgccgct
tcatccaccgagtacctcgcctcgaagctccgctcgtatgctgcgtccatcggtcacttc
aacaaccccaaggagaggcggaagtccaaggccagcctcaagaagtggatcaacgaggag
ctcgtcgtgcccggcctgggcatctccaacgcctccgacgaggagctcgaggccctagcg
gacaacgccgaggcttctctcgagatcttctccgccatgatttccctgcgcgcgcacgtc
ggctggagcacccacgggcacaccgccgtcgacgtcaacatctactcgtctggcgggccc
ggcacgcaggcaatccgcggcaacgtcgagaacacagatgtcggcaagttcttgcgacac
tacctcgatgtggacgatgtggtggaggacattacgaaggagctgagggagaagacggag
aagcctggtgagggcgcaatgagcatggctctcgagggggggagcgttgttggtagttat
cacgcgcaagagatttag

DBGET integrated database retrieval system