KEGG   Trichoderma reesei: TRIREDRAFT_121405Help
Entry
TRIREDRAFT_121405 CDS       T02991                                 

Definition
aminotransferase class-III
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
tre  Trichoderma reesei
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TRIREDRAFT_121405
   00650 Butanoate metabolism
    TRIREDRAFT_121405
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRIREDRAFT_121405
   00280 Valine, leucine and isoleucine degradation
    TRIREDRAFT_121405
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRIREDRAFT_121405
Enzymes [BR:tre01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TRIREDRAFT_121405
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     TRIREDRAFT_121405
Amino acid related enzymes [BR:tre01007]
 Aminotransferase (transaminase)
  Class III
   TRIREDRAFT_121405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MSAVLEPKVTTEIPGPRSRAEAEKLGSFFDNRAFYFVADYDKSSGNYIVDVDGNQFLDVY
SQIASIPVGYNNPGLIKAAQSPEMVSALVNRPALGNFPSSHWHDSLKDGLLKVAPPGCDK
IFTAQSGSEANELAFKAAFMLYRRKERGEGVDWSDSEISSCLNNAKPGSPDLAILSFANS
FHGRGFGSLSATRSKAVHKLDIPSFNWPQAPFPALKYPLDKHAEENAAEEKRCLEKVEEL
ITTWQFPVAGLIVEPIQSEGGDNHASPAFFQGLRDITQKHNVTMIVDEVQTGFGATGKFW
GHQHWNLSSPPDIVTFSKKAQTAGYYFSNPRLVPDKAYRQFNTWIGDPARVLMSKAVVEE
ILSKDLVNQCARVGVALYNELERLAAKYPELVKNLRGKGQGTYIAFDTKDPASLVKKMKS
LGVNIGTCGTQTVRLRPMLIFEEAHIPLLISALDKALGSA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgtgcttgagccaaaggtgacgaccgagatccctggacctcgctccagggcc
gaggccgagaagctgggctctttctttgataaccgagccttttacttcgtggccgactat
gacaagagctcaggcaactacatcgtcgacgtcgacggcaaccagttcctggacgtctac
tcccaaatcgcctccatccccgtaggctacaacaacccgggcctcatcaaggccgcgcag
tcccccgagatggtctccgcgctggtcaaccgcccggccctgggcaacttcccctcgagc
cactggcacgactcgctcaaggacggcctgctcaaggtggcgcccccgggctgcgacaag
atcttcaccgcgcagtccggctccgaggccaacgagctcgccttcaaggccgccttcatg
ctgtaccgccgcaaggagcgcggcgagggcgtcgactggtccgatagcgaaatcagctcg
tgcctcaacaacgccaagccgggctcccccgacctggccatcctcagcttcgccaactcg
ttccacggccgtggcttcgggagcttgagcgccactcgctcaaaggccgtgcacaagctg
gatatcccgtccttcaactggccgcaggcgccgttcccggctctcaagtacccgctggac
aagcatgccgaggagaatgccgctgaggagaagaggtgcctcgagaaggtggaggaactc
atcaccacatggcaattccccgttgctggcttgatcgtcgagcccatccagagcgaagga
ggcgacaaccacgcctcccctgccttcttccagggcctccgtgacattacccagaagcac
aacgtcaccatgatcgtcgacgaggtccagaccggcttcggcgccacgggcaagttctgg
ggccaccagcactggaacctgtcttcgcccccagacattgtcaccttttccaagaaggcc
cagaccgccggttactacttcagcaaccccaggctggtgcccgacaaggcttaccgccag
ttcaacacttggatcggtgacccagcccgtgtcctcatgagcaaggccgtcgtcgaggag
attctctccaaggatctcgtcaaccaatgcgcccgcgtcggtgtcgctctgtacaacgaa
ctcgagcgcctcgccgcgaaatacccggagctcgtcaagaacctccgcggcaaaggccag
ggaacatacattgccttcgacacaaaggatcccgcctccctcgtcaagaagatgaagtct
ctcggcgtcaacatcggcacttgcggcacccagaccgtccgcctccgcccgatgctcatc
tttgaggaagctcacattccccttttgatctcggctttggataaggctcttggctcggcg
taa

DBGET integrated database retrieval system